DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15369 and CYS1

DIOPT Version :9

Sequence 1:NP_001285041.1 Gene:CG15369 / 31862 FlyBaseID:FBgn0030105 Length:122 Species:Drosophila melanogaster
Sequence 2:NP_196775.1 Gene:CYS1 / 831087 AraportID:AT5G12140 Length:101 Species:Arabidopsis thaliana


Alignment Length:72 Identity:19/72 - (26%)
Similarity:34/72 - (47%) Gaps:10/72 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 ASAQQTLEASLTKLAAGEGPHYR-------LSKILSATSQVVSGFKNDYSVELIDNQGATKVCQV 92
            |:|......||.:.|..|  |.:       ..::|.|.:|||:|..:..:||:.|.: ..||.:.
plant    18 ANANDLQVESLARFAVDE--HNKNENLTLEYKRLLGAKTQVVAGTMHHLTVEVADGE-TNKVYEA 79

  Fly    93 DIWSQSW 99
            .:..::|
plant    80 KVLEKAW 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15369NP_001285041.1 CY 24..110 CDD:238002 19/72 (26%)
CYS1NP_196775.1 CY 11..97 CDD:238002 19/72 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1565344at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.