powered by:
Protein Alignment CG15369 and Cst5
DIOPT Version :9
Sequence 1: | NP_001285041.1 |
Gene: | CG15369 / 31862 |
FlyBaseID: | FBgn0030105 |
Length: | 122 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001102431.1 |
Gene: | Cst5 / 366219 |
RGDID: | 1310978 |
Length: | 158 |
Species: | Rattus norvegicus |
Alignment Length: | 74 |
Identity: | 24/74 - (32%) |
Similarity: | 33/74 - (44%) |
Gaps: | 23/74 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 60 KILSATSQVVSGFKNDY-------------SVELID-------NQGATKVCQVDIWSQSWLPNGI 104
:::||:.||||| ||.| ..:|.| :|....||...|..:.|| |.|
Rat 86 RVMSASQQVVSG-KNFYLKIELGQTMCTKAQSDLADCPFNEQPDQQKRAVCNFQINVEPWL-NKI 148
Fly 105 QVT-FRCPN 112
.:| |:|.|
Rat 149 SLTNFKCYN 157
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG15369 | NP_001285041.1 |
CY |
24..110 |
CDD:238002 |
22/70 (31%) |
Cst5 | NP_001102431.1 |
CY |
48..156 |
CDD:214484 |
22/71 (31%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1565344at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.