powered by:
Protein Alignment CG15369 and P22k15
DIOPT Version :9
Sequence 1: | NP_001285041.1 |
Gene: | CG15369 / 31862 |
FlyBaseID: | FBgn0030105 |
Length: | 122 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_954887.1 |
Gene: | P22k15 / 296229 |
RGDID: | 727814 |
Length: | 176 |
Species: | Rattus norvegicus |
Alignment Length: | 39 |
Identity: | 8/39 - (20%) |
Similarity: | 17/39 - (43%) |
Gaps: | 4/39 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 57 RLSKILSATSQVVSGFKNDYSVELIDNQGATKVCQVDIW 95
:|:.:......:.:.|.:|..:..|.||..| ::.|
Rat 45 KLNDVYDIFKFLYNKFSHDTYLSNIKNQSFT----MNTW 79
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG15369 | NP_001285041.1 |
CY |
24..110 |
CDD:238002 |
8/39 (21%) |
P22k15 | NP_954887.1 |
CY |
41..135 |
CDD:238002 |
8/39 (21%) |
CY |
<117..174 |
CDD:298856 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1565344at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.