DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15369 and cpi-2

DIOPT Version :9

Sequence 1:NP_001285041.1 Gene:CG15369 / 31862 FlyBaseID:FBgn0030105 Length:122 Species:Drosophila melanogaster
Sequence 2:NP_504565.1 Gene:cpi-2 / 178992 WormBaseID:WBGene00000534 Length:143 Species:Caenorhabditis elegans


Alignment Length:123 Identity:28/123 - (22%)
Similarity:48/123 - (39%) Gaps:34/123 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ILCTACVLVSATPFGLGAPKVLEG----EDLASAQQTLEA-----SLTKLAAGEGPHYRLS-KIL 62
            ||..|.:.:|......|   ::.|    :|.:..:.:.:|     .:...|:..||:|... |:.
 Worm     4 ILVFALIAISIISVNAG---MMTGGSVEQDASQKEYSDKAWKAVKGINDQASNNGPYYYAPIKVT 65

  Fly    63 SATSQVVSGFKNDYSV----------EL-----------IDNQGATKVCQVDIWSQSW 99
            .|::|||:|......|          ||           |.:.|:..:.||.||.:.|
 Worm    66 KASTQVVAGISTKLEVLVGESNCKKGELQAHEITSSNCQIKDGGSRALYQVTIWEKPW 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15369NP_001285041.1 CY 24..110 CDD:238002 24/107 (22%)
cpi-2NP_504565.1 CY 21..126 CDD:214484 23/103 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1565344at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.