DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir94a and Ir7d

DIOPT Version :9

Sequence 1:NP_732699.1 Gene:Ir94a / 318610 FlyBaseID:FBgn0051164 Length:595 Species:Drosophila melanogaster
Sequence 2:NP_001138175.1 Gene:Ir7d / 7354416 FlyBaseID:FBgn0259190 Length:594 Species:Drosophila melanogaster


Alignment Length:684 Identity:127/684 - (18%)
Similarity:215/684 - (31%) Gaps:279/684 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 EIFLNRLLQAVHN----------ERSVETLFLLHHSNLANCSLQDWNPPRIPT------------ 73
            :||:|.|  ||:|          |...:.:.|:|  .:.|.:|.   ||..|.            
  Fly    41 KIFINGL--AVYNFGVFISTSYEEMDRDRVILVH--QVLNRNLY---PPNFPVAVVLASKMNRKI 98

  Fly    74 ---IRSNELTVFNVEKTF------NHNALALVCLMKNSYREILNTLAKSFDCMRQER----IILM 125
               :.:..|.|.|.|:..      |.|.|.::.|:.:.....:.|  |.|....|||    ::::
  Fly    99 TAQVFTQLLFVQNAEQAIAIAEGVNRNGLCVIVLLTSQPERPIMT--KIFTYFMQERYNINVVIL 161

  Fly   126 IHR-------------KSDSKFIEDITHEVKNLQFLHLIVLIVQEKYNGQVFASTLRLQSFPEPH 177
            :.|             .:....:|.:..::|                :|.::      ..||   
  Fly   162 VPRLHGVQAFNVRPYTPTSCSSLEPVEIDIK----------------DGDLW------DVFP--- 201

  Fly   178 FKRIRNVFAIQRIFYRPINFHGKVLNAIPNDIPILFVALNEMFTE---------------YARRY 227
             :|::|:             ||..|:.|..||| .::.:|...::               .||:.
  Fly   202 -RRLKNL-------------HGCPLSVIVWDIP-PYMRINWKSSDPMDGLDGLDGLLLRIVARKM 251

  Fly   228 NSTLRIQNRTIKEDIEITEDNYDIDMKIQLHNSQNFLHHMNIAMDIGSNSLI------------- 279
            |.||::                       :.|..|.|        ||.:|.:             
  Fly   252 NFTLKL-----------------------IPNEPNGL--------IGGSSFMNGTFTGAYKMLRE 285

  Fly   280 ----ILVPCA-------TELRGLDIFKELGVRTLTWLALLFYIIFVLVE--------MLFVFISN 325
                |.:.||       |.|.....:.::.           |||.:...        |||.|   
  Fly   286 RRANITIGCAACTPERSTFLEATSPYSQMS-----------YIIVLQARGGYSIYEVMLFPF--- 336

  Fly   326 RFNGRNFTMRYTNPLIN-LRAVRAILG----QTSPISNRYSLSIQHFFVFMSLFGTLFGGFFDCK 385
                    .:||..|:: :..:..|:|    ..|||...:.|.|  |.:..|...::|       
  Fly   337 --------EKYTWLLLSTILGLHWIVGSRWRMPSPILAGWMLWI--FVIRASYEASVF------- 384

  Fly   386 LRSFLTKRPYYSQIENFSELRKSGVTVVVDHTTRQFIEQEINANFFRDEVPNVRTTTIQELINHV 450
              :|:...|.........:....|...:.||.:.:...          ::|:.:..|:......|
  Fly   385 --NFIQNSPVKPSPRTLDQALSGGFRFITDHASYRMTL----------KIPSFQGKTLISAGQPV 437

  Fly   451 YSYDRKFAFVANSIPWRT------------FREEMKSINQKILCDSKNLTILENV---------- 493
            ..:|...     ..||:|            .....|..||.::...|   |::|:          
  Fly   438 DVFDALL-----KAPWKTGAFTSRAFLADHLVRHRKHRNQLVILAEK---IVDNMLCMYFPHGSY 494

  Fly   494 ------PLTFSIRRNAIFSHHLRNFIINAADSGMITCWFKMAGKVIR---KHIKTTLRESEQQPS 549
                  .|.|::|...||.||.:   |.|.|:...|......||.|.   :.:.|...||     
  Fly   495 FAWEINKLLFNMRSFGIFQHHSQ---ILAWDNLPTTTDTDTPGKRIHSSTESVATGFAES----- 551

  Fly   550 HLPLSF--DHFKWLWAVLCIAYVMSFMVFVMEIL 581
               :||  .....|...|||    |.:||.:|:|
  Fly   552 ---MSFVVAALNCLMGALCI----SIVVFGLELL 578



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.