DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir94a and Ir94h

DIOPT Version :9

Sequence 1:NP_732699.1 Gene:Ir94a / 318610 FlyBaseID:FBgn0051164 Length:595 Species:Drosophila melanogaster
Sequence 2:NP_651148.2 Gene:Ir94h / 42769 FlyBaseID:FBgn0039080 Length:559 Species:Drosophila melanogaster


Alignment Length:609 Identity:118/609 - (19%)
Similarity:215/609 - (35%) Gaps:159/609 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 SVETLFLLHHSNLANCSLQDWNP-PRIPTIRSN--------ELTVFNVEKTFNHNALALVCLMKN 101
            |.||.....:.....||   |.. ||  ||.||        |.|...:.|..:.|...:.||...
  Fly    26 SSETTLFYFNPTGQKCS---WETLPR--TILSNHPQIIWFREETYPGLYKRHSSNLFVMACLSST 85

  Fly   102 SYREILNTLAKSFDCMRQERIILMIHRKSDSKFIEDITHEVKNLQFLHLIVL------------- 153
            ||...|..||:|....|..|:::.:..|..|.....|....:....|::::.             
  Fly    86 SYDGQLQLLAESLTRYRSVRVLIEVQDKEGSFLASQILLLCQQHSMLNVVLYFSRWTRTLNVFSY 150

  Fly   154 -------IVQEKYNG----QVFASTLR-LQSFPEPHFKRIRNVFAIQRIFYRPINF-----HGK- 200
                   :::::.:|    ::|.:.|: ||.:      :||    :|.....|.:|     ||: 
  Fly   151 LAFPYFKLLKQRLSGSLRPKIFINQLKDLQGY------KIR----VQPDLSPPNSFSYRDRHGEC 205

  Fly   201 ---------VLN---AIPNDIPILF-------VALNEMFTEYARRYNSTLRIQNRTIKEDIEITE 246
                     |.|   ::..|..:|:       |:..|...::.|..:|           ||.:| 
  Fly   206 QVGGFLWRIVENFSKSLKGDTQVLYPTWAKAKVSAAEYMIQFTRNGSS-----------DIGVT- 258

  Fly   247 DNYDIDMKIQLHNSQNFLHHMNIAMDIG-SNSLIILVPCATELRGLDIFKE-LGVRTLTWLALLF 309
                 ...|...:.:.:..:.....||. ...|.:..|.:.|:    :|.. |...:...|.|.|
  Fly   259 -----TTMITFKHEERYRDYSYPMYDISWCTMLPVEKPLSVEI----LFSHVLSPGSALLLILAF 314

  Fly   310 YIIFVLVEMLFVFISNRFNGRNFTMRYTNPLINLRAVRAILGQTSPISNRYSLSIQHFFVFMSLF 374
            .:.|::|..|...:...|.||                  ::|..|.|           |..:.|.
  Fly   315 ILFFLIVPQLIKCLGITFRGR------------------LIGMASRI-----------FALVMLC 350

  Fly   375 GTLFGGFFDCKLRSFLTKRPYYSQIENFSELRKSGVTVVVDHTTRQFIEQEINAN----FFRDEV 435
            .:      ..:|.|.|...|.:::|::|.:|..||:.:....:...|::....|.    |...|.
  Fly   351 SS------SAQLLSLLMSPPLHTRIKSFDDLLTSGLKIFGIRSELYFLDGGFRAKYASAFHLTEN 409

  Fly   436 PNVRTTTIQELINHVYSYDRKFAFVANSIPWRTFREEMKSINQKILCDSKNLTILENVPLTFSIR 500
            ||       ||.::...::..:|:...|:.|.....:.:.....:...|.:|......|....|.
  Fly   410 PN-------ELYDNRNYFNTSWAYTITSVKWNVIEAQQRHFAHPVFRYSTDLCFSSETPWGLLIA 467

  Fly   501 RNAIFSHHLRNFIINAADSGMITCWFKM-------AGKV-IRKHIKTTLRESEQQPSHLPLSFDH 557
            ..:.:...|::|.:....:|:||.|...       ||:: |:.:.:|.|.:        ||....
  Fly   468 PESFYREPLQHFTLKINQAGLITQWMTQSFHEMVRAGRMTIKDYSRTNLMK--------PLRIQD 524

  Fly   558 FKWLWAVLCIAYVMSFMVFVMEIL 581
            .:..|.:..:....|.:||.:|:|
  Fly   525 LRKCWVIFAVGLGTSTVVFTIELL 548



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.