DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir94a and Ir67b

DIOPT Version :9

Sequence 1:NP_732699.1 Gene:Ir94a / 318610 FlyBaseID:FBgn0051164 Length:595 Species:Drosophila melanogaster
Sequence 2:NP_648393.1 Gene:Ir67b / 39194 FlyBaseID:FBgn0036083 Length:574 Species:Drosophila melanogaster


Alignment Length:662 Identity:121/662 - (18%)
Similarity:231/662 - (34%) Gaps:192/662 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 QLKFINIFLVLLIIYGSSDGTENQHEIFLNRLLQAV---HNERSVETLFLLHHSNLANC--SLQD 65
            :|.::|....|.::.|             |||:|.|   :|....|....|...|.|:.  |.|.
  Fly     2 ELLYLNTLQSLSLLEG-------------NRLVQTVQELNNIYQTELNVFLEFGNGADILESAQG 53

  Fly    66 ------W--NPPRIPTIRSN----ELTVFNVEKTF--------------NHNALALVCLMKNSYR 104
                  |  ||.....::.|    .||:..:|...              .|:...|:.....||.
  Fly    54 TFVPTLWIKNPQNQKVMKGNFTSCTLTILYLEDEHLDRGLYYLANWLWEYHHLEVLIFFNGGSYD 118

  Fly   105 EILNTLAKSFDCMRQERI-ILMIHRKSDSKF----IEDITHEVKNLQFLHLIVLIVQEK-----Y 159
            :::...::   |..:..: :|::...||..:    .:|:  ::.||:.:.....:.::|     |
  Fly   119 KLIQIFSR---CFNEGFVNVLVMLPGSDELYTFMPYQDL--KILNLKSIKEFYSLSRKKMDLNGY 178

  Fly   160 N---GQVFASTLRLQSFPEPHFKRIRNVFAIQRIFYRPINFHGKVLNAIPNDIPILFVALNEMFT 221
            |   |.|.|...|..||.:...:.|...:.::                              |..
  Fly   179 NITSGLVIAGAPRWFSFRDRQNRLILTGYMLR------------------------------MIV 213

  Fly   222 EYARRYNSTLRIQN-RTIKEDIEITEDNYDIDM------KIQLHNSQNFLHHMNIAMDIGS---- 275
            ::...:|.::|:.| .|:.:.:|:.. |..||.      .::..:..|.|:..|..:.:.:    
  Fly   214 DFTNHFNGSVRLMNVLTVNDGLELLA-NRTIDFFPFLIRPLKSFSMSNILYLENCGLIVPTSRPL 277

  Fly   276 -NSLIILVPCATELRGLDIFKELGVRTLTWLALLFYIIFVLVEMLF-----VFISNRFNGRNFTM 334
             |.:.:|.|.|.:               ||:|.|..:|:..:.:..     :.||..|       
  Fly   278 PNWVYLLRPYAFD---------------TWIAWLIMLIYCSLALRILSKGQISISAAF------- 320

  Fly   335 RYTNPLINLRAVRAILGQ----TSPISNRYSLSIQHFFVFMSLFGTLFGGFFDCKLRSFLTKRPY 395
                 |..||.|..:.|.    |.|.:.|..|     ||.::..|.:....:..:|.|......|
  Fly   321 -----LKVLRLVMYLSGSRDMGTRPTTRRLFL-----FVILTTSGFILTNLYVAQLSSNSAAGLY 375

  Fly   396 YSQIENFSELRKS-GVTVVVD---HTTRQFIEQ------------EINANFFRDEVPNVRTTTIQ 444
            ..||..:.:|.|| .:..::|   .|..:.|..            |.:.:.:|   .|:.|:.| 
  Fly   376 EKQINTWEDLDKSDSIWPLIDVDIKTMEKLIPDRTKLLKKIVPTLEADVDTYR---RNLNTSCI- 436

  Fly   445 ELINHVYSYDR-KFA-FVANSIPWRTFREEMKSINQKILCDSKNLTILENVPLTFSIRRNAIFSH 507
                |...:|| .|| :....:.:..||              |...:|...||..|......:..
  Fly   437 ----HSGFFDRIDFALYQQKFLRFPIFR--------------KFPHLLYQQPLQISAAFGRPYLQ 483

  Fly   508 HLRNFIINAADSGMITCWFKMAGKVIRKHIKTTLRESEQQPSHLPLSFDHFKWLWAVLCIAY--- 569
            ....|:....:||:   :.||.....|..|::.|.....:..||.:..:..::.:.:..:.:   
  Fly   484 LFNWFVRKIFESGI---YLKMKDDAYRHGIQSGLLNLAFRDRHLEVKSNDVEYYYLIAGLWFGGL 545

  Fly   570 VMSFMVFVMEIL 581
            .::.:.|::|:|
  Fly   546 TLATVCFLLELL 557



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.