DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir94a and Ir56b

DIOPT Version :9

Sequence 1:NP_732699.1 Gene:Ir94a / 318610 FlyBaseID:FBgn0051164 Length:595 Species:Drosophila melanogaster
Sequence 2:NP_611430.1 Gene:Ir56b / 37250 FlyBaseID:FBgn0034456 Length:408 Species:Drosophila melanogaster


Alignment Length:421 Identity:85/421 - (20%)
Similarity:169/421 - (40%) Gaps:64/421 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 PINF---HGKVLNAIPNDIPILFVALNEMFTEYARRYNSTL------RIQNRTIKEDIEITEDNY 249
            |.:|   |..:.|.....:|.......|:...:|..|:..|      .:..:::.|. :|....|
  Fly    15 PYSFDIPHAFIFNETQFVVPKFCGPYMEIVKHFAEVYHYQLFLDSLESLPKKSVVEQ-DIISGKY 78

  Fly   250 DIDMK---IQLHNSQNFLHHMNIAMDIGSNSLIILVPCATEL-RGLDIFKELGVRTLTWLAL-LF 309
            ::.:.   |:...:.:|.:....:..:...:..::||.|.|| :.:.:...||....|.|.| .|
  Fly    79 NLSLHGVIIRPEETSDFFNATQHSYPLELMTNCVMVPLAPELPKWMYMVWPLGKYIWTCLFLGTF 143

  Fly   310 YIIFVLVEMLFVFISNRFNGRNFTMRYTNPLINLRAVRAILGQTSPISNRYSLSIQH-------F 367
            |     |.:|..::..|..| |.|..||..:::..|:.......:     .|:.::|       |
  Fly   144 Y-----VALLLRYVHWREPG-NATRSYTRNVLHAMALLMFSANMN-----MSVKLKHASIRVIIF 197

  Fly   368 FVFMSLFGTLFGGFFDCKLRSFLTKRPYYSQIENFSELRKSGVTVVVDHTTRQFIEQEINANFFR 432
            :..:.:||.:...:....:.:|..|..:...|:.:|:|..|.:.:|:..:   .:|:        
  Fly   198 YTLLYIFGFILTNYHLSHMTAFDMKPVFLRPIDTWSDLIHSRLRIVIHDS---LLEE-------- 251

  Fly   433 DEVPNVRTTTIQELINHVYSYDRKFAFVANSIPWRTFREEMKSINQKILCDSKNL--TILENVPL 495
                 :|...:.:.:  :.|..|.:|:|.....|..|..:.|.:.|.....||..  .:...:|:
  Fly   252 -----LRWLPVYQAL--LASPSRSYAYVVTQDAWLFFNRQQKVLIQPYFHLSKVCFGGLFNALPM 309

  Fly   496 TFSIRRNAIFSHHLRNFIINAADSGMITCWFKMAGKVIRK--HIKTTLRESEQQPSHLPLSFDHF 558
            .    .||.|:..|..||:|...:|:...|.::|.:...:  :.|..|   :..|.. ||:.:.|
  Fly   310 A----SNASFADSLNKFILNVWQAGLWNYWEELAFRYAEQAGYAKVFL---DTYPVE-PLNLEFF 366

  Fly   559 KWLWAVLCIAYVMSFMVFVMEI-LWSKYQRR 588
            ...|.||.....:|.:.|.:|: :..:.|||
  Fly   367 TTAWIVLSAGIPISSLAFCLELFIHRRKQRR 397



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.