DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir94a and Ir40a

DIOPT Version :10

Sequence 1:NP_732699.1 Gene:Ir94a / 318610 FlyBaseID:FBgn0051164 Length:595 Species:Drosophila melanogaster
Sequence 2:NP_610140.4 Gene:Ir40a / 35449 FlyBaseID:FBgn0259683 Length:732 Species:Drosophila melanogaster


Alignment Length:351 Identity:69/351 - (19%)
Similarity:107/351 - (30%) Gaps:120/351 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   311 IIFVLVEMLFVFISNRFNGRNFTMRYTNPLINLRAVRAILGQTSPISNRYSLSIQHFFVFMSLFG 375
            ::|...|:.|..|.....|.|            ..:..||.:.:.:.|  ||..:|....:|||.
  Fly    86 VVFSQTELFFQHIEENLQGAN------------ECISLILDEPNQLLN--SLHDRHLGHRLSLFI 136

  Fly   376 TLFGG---------FFDCKLRSFLTKRP-------YYSQ-------------------------- 398
            ..:|.         .|...||..:..||       ||:|                          
  Fly   137 FYWGARWPPSSRVIRFREPLRVVVVTRPRKKAFRIYYNQARPCSDSQLQLVNWYDGDNLGLQRIP 201

  Fly   399 -----IENFSELRKSGVTVVVDHTTRQFIEQEINANFFRDEVPN---------VRTT------TI 443
                 :..::..:.....|.|.|:...|.....|.:|..||..|         ||.|      .:
  Fly   202 LLPTALSVYANFKGRTFRVPVFHSPPWFWVTYCNNSFEEDEEFNSLDSIEKRKVRVTGGRDHRLL 266

  Fly   444 QELINHVYSYDRKFAFVANSIPWRTFREEMKSINQKILCDS--KNLTILENVPLTFSI------- 499
            ..|..|:     .|.|.....|.|| :..|:|.:.|...||  ..:.:|::....|.:       
  Fly   267 MLLSKHM-----NFRFKYIEAPGRT-QGSMRSEDGKDSNDSFTGGIGLLQSGQADFFLGDVGLSW 325

  Fly   500 -RRNAI-FSHHLRNFIINAADSGMITCWFKMAGKVIRKHIKTTLRESEQQPSHLPLSFDHFKWLW 562
             ||.|| ||      ....||||           ....|....|.|:      |.:.....:.:|
  Fly   326 ERRKAIEFS------FFTLADSG-----------AFATHAPRRLNEA------LAIMRPFKQDIW 367

  Fly   563 AVLCIAYVMSFMVF----VMEILWSK 584
            ..|.:..:.|..:|    .:..:|.:
  Fly   368 PHLILTIIFSGPIFYGIIALPYIWRR 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir94aNP_732699.1 None
Ir40aNP_610140.4 Lig_chan-Glu_bd <265..336 CDD:463166 20/82 (24%)
Periplasmic_Binding_Protein_Type_2 297..>391 CDD:473866 22/116 (19%)
Periplasmic_Binding_Protein_Type_2 <496..637 CDD:473866
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.