DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir94a and Ir10a

DIOPT Version :9

Sequence 1:NP_732699.1 Gene:Ir94a / 318610 FlyBaseID:FBgn0051164 Length:595 Species:Drosophila melanogaster
Sequence 2:NP_001096949.1 Gene:Ir10a / 32067 FlyBaseID:FBgn0083979 Length:609 Species:Drosophila melanogaster


Alignment Length:471 Identity:89/471 - (18%)
Similarity:170/471 - (36%) Gaps:139/471 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 LRLQSF----PEPHF-------KRIRNV-FAIQRIFYRPINFHGKVLNAIPNDIPILFVALNEMF 220
            ||:|.|    ..|.|       .|:..| |.:.::....:||  .:|...|.         .:.|
  Fly   193 LRIQMFRSVYTRPEFDKETGLLTRVTGVDFLVAQMLRERLNF--TMLLQQPE---------KKYF 246

  Fly   221 TEYARR--YNSTLRIQNRTIKEDIEITEDNYDI-DMKIQLHNSQNFLHHMNIAMDIGSNSLIILV 282
            .|.:..  ||..:   ...||:.::|....:.: |..:|        .:|:..:.:..:.|.|.|
  Fly   247 GERSANGSYNGAI---GSIIKDGLDICLTGFFVKDYLVQ--------QYMDFTVAVYDDELCIYV 300

  Fly   283 PCATELR---------GLDIFKELGVRTLTWLALLFYIIFVLVEMLFVFISNRFNGRNFTMRYTN 338
            |.|:.:.         |.||          ||.      |||.......|.       .|:|..|
  Fly   301 PKASRIPQSILPIFAVGYDI----------WLG------FVLTAFACALIW-------LTLRVIN 342

  Fly   339 PLINLRAV----RAILGQ-------TSPISNRYSLS------IQHFFV-FMSLFGTLFGGFFDCK 385
              :.||.|    :.|:||       |..:..|.:||      .:..|: .:.|...:||..|:..
  Fly   343 --LKLRIVSLGNQHIVGQALGIMVDTWVVWVRLNLSHLPASYAERMFIGTLCLVSVIFGAIFESS 405

  Fly   386 LRSFLTKRPYYSQIENFSELRKSGVTVVVDHTTRQFIEQEINANFFRDEVPNVRTTTIQELINHV 450
            |.:......||..|....||.:||:.||..:::            ..|::....|:.:...:|..
  Fly   406 LATVYIHPLYYKDINTMQELDESGLKVVYKYSS------------MADDLFFSETSPLFASLNKK 458

  Fly   451 YSYDRKF-AFVANSIPWRTFREEM-KSINQKILCDSKNLTILENV----------PLTFSIRRNA 503
            .|::|.. |.|.:.:  ..||.:. .|....::.:|.:.|:|..:          .:::.:.|::
  Fly   459 LSWNRDLRADVIDEV--ARFRNKAGVSRYTSLILESSHFTLLRKIWVVPECPKYYTISYVMPRDS 521

  Fly   504 IFSHHLRNFIINAADSGMITCWFKMAGKVIRKHIKTTLRESEQQP--------SHLPLSF----- 555
            .:...:...::...::|:|..|.:.....:...:::.:.|::.:.        ..|.|:|     
  Fly   522 PWEDAVNALLLRFLNAGLIVKWIQDEKSWVDIKMRSNILEADAESELVRVLTIGDLQLAFYVVIG 586

  Fly   556 -----------DHFKW 560
                       :||:|
  Fly   587 GNLLAFLGFLAEHFRW 602

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir94aNP_732699.1 None
Ir10aNP_001096949.1 Periplasmic_Binding_Protein_Type_2 220..>294 CDD:304360 16/95 (17%)
TM_PBP1_branched-chain-AA_like 315..>411 CDD:294309 28/120 (23%)
Lig_chan 319..587 CDD:278489 57/306 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.