DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir94a and Ir7b

DIOPT Version :9

Sequence 1:NP_732699.1 Gene:Ir94a / 318610 FlyBaseID:FBgn0051164 Length:595 Species:Drosophila melanogaster
Sequence 2:NP_572410.2 Gene:Ir7b / 31690 FlyBaseID:FBgn0029965 Length:655 Species:Drosophila melanogaster


Alignment Length:332 Identity:60/332 - (18%)
Similarity:119/332 - (35%) Gaps:84/332 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   315 LVEMLFVFISNRFNGRNF----TMRYTNPLINLRAVRAILGQTSPISNRY-----SLSIQHFFVF 370
            |::.:.:.:.|....|..    :|.| .|.::  ||.|::.....:|..|     :..:.|..::
  Fly    63 LLDQVLMIVPNNLQARRLLLQQSMEY-KPYVH--AVLALVDGLPSLSAIYARIRATQDLSHTLIY 124

  Fly   371 MSLFGTLFGGFFDCKLRSFLTK----------RP---------YYSQIENFSELRKSGVTVVVDH 416
            ||:....:|......|| ||.:          ||         |:.    ||.|.  |..|:..:
  Fly   125 MSMPTDAYGEEMQATLR-FLWRLSVLNVGVVLRPPGDHILMVSYFP----FSALH--GCQVISAN 182

  Fly   417 TTRQF---IEQEINANFFRDEVPN-----VRTTTIQELINHVYSYDRKFAFVANSIPWRTFREEM 473
            ...::   .::..:.::|..::.|     :...|.:::...|:..|...:||.           :
  Fly   183 VVNRYQVGTKRWASQDYFPSKLGNFYGCLLTCATWEDMPYLVWRPDGSGSFVG-----------I 236

  Fly   474 KSINQKILCDSKNLTI------LENVPLTFSIRR---NAIFSHHLRNFIINAADSGMITCWFK-M 528
            :....:.:.::.|.|:      .|.|..||....   :.||.||        ||..:....|| .
  Fly   237 EGALLQFMAENLNFTVGLYWMNKEEVLATFDESGRIFDEIFGHH--------ADFSLGGFHFKPS 293

  Fly   529 AGKVI---------RKHIKTTLRESEQQPSHLPLSFDHFKWLWAVLCIAYVMSFMVFVMEILWSK 584
            ||..|         ..||...........::..|||.....||..:.:..:::.::.::.:.|..
  Fly   294 AGSEIPYSQSTYYFMSHIMLVTNLQSAYSAYEKLSFPFTPLLWRAIGLVLILACLLLMLLVRWRH 358

  Fly   585 YQRRTRS 591
            :....|:
  Fly   359 HHELPRN 365



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.