DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15368 and AT4G14225

DIOPT Version :10

Sequence 1:NP_572541.1 Gene:CG15368 / 31861 FlyBaseID:FBgn0030104 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_680686.1 Gene:AT4G14225 / 827063 AraportID:AT4G14225 Length:125 Species:Arabidopsis thaliana


Alignment Length:97 Identity:36/97 - (37%)
Similarity:48/97 - (49%) Gaps:20/97 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 VNSKDGAANQDTSADSGQDQDGNQAQDST----KKRCDKCGKKLGITGGFPCRCGGTYCAVHRYS 130
            ||:|  ||.:.|            ||::|    |..| .|.||:|:. ||.||||..:.|.|||.
plant    45 VNTK--AAEEVT------------AQEATVLGSKGGC-ACKKKVGLL-GFHCRCGHLFFASHRYP 93

  Fly   131 DRHECNFDYRQMGAIQIRRDNPVVVASKLRKL 162
            :.|.|..||:......:.:.||||...||.:|
plant    94 EEHSCPSDYKSAAIDVLAKQNPVVKGDKLFRL 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15368NP_572541.1 ZnF_AN1 102..140 CDD:197545 18/37 (49%)
AT4G14225NP_680686.1 zf-A20 6..29 CDD:460313
ZnF_AN1 69..103 CDD:197545 17/34 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.