DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15368 and Zfand6

DIOPT Version :10

Sequence 1:NP_572541.1 Gene:CG15368 / 31861 FlyBaseID:FBgn0030104 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_075361.2 Gene:Zfand6 / 65098 MGIID:1929510 Length:223 Species:Mus musculus


Alignment Length:152 Identity:52/152 - (34%)
Similarity:79/152 - (51%) Gaps:13/152 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SGMDAGTQSAMSIQLHGFSHHLEQRDQEERDQGDAQ-EQQQPQQQQDQPPMEEQDSRAVNSKDGA 76
            |.|..|..|..|:.....:.  .|.|....|:..:: |..|..:.:...|:|.....:|:     
Mouse    83 SSMQPGPVSNQSLLSESVAP--SQVDSTSVDKAVSETEDLQGPRAEGLVPLECDPPSSVS----- 140

  Fly    77 ANQDTSADSGQDQDGNQAQDSTKK-RCDKCGKKLGITGGFPCRCGGTYCAVHRYSDRHECNFDYR 140
               ||:....::|..:..:...|| ||..|.||:|:| ||.||||..||.||||||.|.|:::|:
Mouse   141 ---DTTQQPSEEQSKSLEKPKQKKNRCFMCRKKVGLT-GFECRCGNVYCGVHRYSDVHNCSYNYK 201

  Fly   141 QMGAIQIRRDNPVVVASKLRKL 162
            ...|.:||::|||||..|::|:
Mouse   202 ADAAEKIRKENPVVVGEKIQKI 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15368NP_572541.1 ZnF_AN1 102..140 CDD:197545 22/37 (59%)
Zfand6NP_075361.2 zf-A20 12..35 CDD:460313
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 41..155 16/81 (20%)
ZnF_AN1 164..201 CDD:197545 22/37 (59%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.