DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15368 and zfand5

DIOPT Version :10

Sequence 1:NP_572541.1 Gene:CG15368 / 31861 FlyBaseID:FBgn0030104 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_001017128.1 Gene:zfand5 / 549882 XenbaseID:XB-GENE-966583 Length:211 Species:Xenopus tropicalis


Alignment Length:102 Identity:39/102 - (38%)
Similarity:63/102 - (61%) Gaps:10/102 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 PMEEQDSRAVNSKDGAANQDTSADSGQDQDGNQAQDSTKKRCDKCGKKLGITGGFPCRCGGTYCA 125
            |:..|.|.:|:....:.|::.:.:..:.:         |.||..|.||:|:| ||.||||..:|.
 Frog   120 PVVTQPSPSVSQPSTSLNEEKAPELPKPK---------KNRCFMCRKKIGLT-GFDCRCGNLFCG 174

  Fly   126 VHRYSDRHECNFDYRQMGAIQIRRDNPVVVASKLRKL 162
            :|||||:|.|.:||:...|.:||::||||||.|::::
 Frog   175 LHRYSDKHNCPYDYKAEAAAKIRKENPVVVAEKIQRI 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15368NP_572541.1 ZnF_AN1 102..140 CDD:197545 21/37 (57%)
zfand5NP_001017128.1 zf-A20 12..35 CDD:460313
ZnF_AN1 152..189 CDD:197545 21/37 (57%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.