DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15368 and zgc:77486

DIOPT Version :10

Sequence 1:NP_572541.1 Gene:CG15368 / 31861 FlyBaseID:FBgn0030104 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_998037.1 Gene:zgc:77486 / 405808 ZFINID:ZDB-GENE-040426-2056 Length:238 Species:Danio rerio


Alignment Length:66 Identity:21/66 - (31%)
Similarity:30/66 - (45%) Gaps:6/66 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 QQQPQQQQDQPPMEEQDSRAVNSKDGAANQDTSADSGQDQDGNQAQDSTKK--RCDKCGKKLGIT 112
            |.......|:..:||::....:...|...:...|.|    ||:|..|..||  ||..|.||:|:|
Zfish   106 QDTATTDSDRAEVEEEEEEGSSKSTGPVGEAAQASS----DGDQTPDKNKKKNRCFTCRKKVGLT 166

  Fly   113 G 113
            |
Zfish   167 G 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15368NP_572541.1 ZnF_AN1 102..140 CDD:197545 7/12 (58%)
zgc:77486NP_998037.1 zf-A20 12..35 CDD:460313
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.