DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15368 and Zfand3

DIOPT Version :10

Sequence 1:NP_572541.1 Gene:CG15368 / 31861 FlyBaseID:FBgn0030104 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_001012175.1 Gene:Zfand3 / 361816 RGDID:1307113 Length:227 Species:Rattus norvegicus


Alignment Length:180 Identity:42/180 - (23%)
Similarity:73/180 - (40%) Gaps:43/180 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 DAGTQSAMSIQLHGFSHHLEQRDQEERDQG------DAQEQQQPQQQQDQPPMEEQ-----DSRA 69
            |..|.|..:.|...||   |:...:..:..      ...:|..|.:.....|.||:     |:..
  Rat    46 DDSTPSTSNSQSDLFS---EETTSDNNNTSVTTPTLSPSQQSLPTELNVTSPSEEECGPCTDTAH 107

  Fly    70 VN------SKDGAANQDTSADS-----------GQDQDGNQAQDSTKKRCDKCGKKLGIT----G 113
            |:      ...||.:|..|..|           .:.::..:::..:::||.:|..||.:.    |
  Rat   108 VSLITPTKRSCGADSQSESEASPVKRPRLVENPERPEESGRSKQKSRRRCFQCQTKLELVQQELG 172

  Fly   114 GFPCRCGGTYCAVHRYSDRHECNFDYRQMGAIQIRRDNPVVVASKL-RKL 162
            .  ||||..:|.:||..::|:|.||:...|     |:..::...|| ||:
  Rat   173 S--CRCGYVFCMLHRLPEQHDCTFDHMGRG-----REEAIMKMVKLDRKV 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15368NP_572541.1 ZnF_AN1 102..140 CDD:197545 16/41 (39%)
Zfand3NP_001012175.1 zf-A20 <19..36 CDD:460313
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 41..151 19/107 (18%)
CUZ1 174..>194 CDD:442801 9/19 (47%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.