DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15368 and zfand4

DIOPT Version :10

Sequence 1:NP_572541.1 Gene:CG15368 / 31861 FlyBaseID:FBgn0030104 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_001189400.1 Gene:zfand4 / 100148477 ZFINID:ZDB-GENE-090312-102 Length:673 Species:Danio rerio


Alignment Length:65 Identity:28/65 - (43%)
Similarity:42/65 - (64%) Gaps:0/65 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 TKKRCDKCGKKLGITGGFPCRCGGTYCAVHRYSDRHECNFDYRQMGAIQIRRDNPVVVASKLRKL 162
            :.|.|..||||.|:...:.||||..:|::||||:.|:|.:||:..|...::..||:|.|.||.|:
Zfish   609 SSKHCFLCGKKTGLATSYECRCGNIFCSIHRYSETHDCTYDYKSAGRRFLQETNPIVSAPKLPKI 673

  Fly   163  162
            Zfish   674  673

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15368NP_572541.1 ZnF_AN1 102..140 CDD:197545 18/37 (49%)
zfand4NP_001189400.1 Ubl_ZFAND4 28..101 CDD:340500
ZnF_AN1 613..651 CDD:197545 18/37 (49%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.