DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31157 and AT5G51150

DIOPT Version :9

Sequence 1:NP_001097769.2 Gene:CG31157 / 318608 FlyBaseID:FBgn0051157 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_199928.1 Gene:AT5G51150 / 835189 AraportID:AT5G51150 Length:531 Species:Arabidopsis thaliana


Alignment Length:328 Identity:52/328 - (15%)
Similarity:106/328 - (32%) Gaps:115/328 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 FNIGLVHSPMAQTLLFMISSVIVLHYQQTRKYSGFWFIRPASLPEDTEDW-----TILKQVQQGI 205
            |::...|.....:|||.::...|:       ||  :.:||.:||:...::     .:.:.|.|.:
plant   206 FHLWGSHWRHGDSLLFSLACAQVM-------YS--FIMRPETLPKSYREFIQKTGPVARPVYQAV 261

  Fly   206 RE-----------LRSYLG-----------------------------IGLAMDLLNPLMKRNMK 230
            ||           |.:|:.                             :....:.::...|:...
plant   262 RECCRGGPIDVASLSAYISSKNEASDVKVEEFASIIPCAAIHPNTNSCLAQNANAMSATFKKTFP 326

  Fly   231 LW------------------------------RPKMTSFLAGYIGLFKVVQLLLLKRLNVNQANA 265
            |:                              ..:.||||:.::|:|:.  .:...|....:.:.
plant   327 LYFSLTFVPYVVLHLQKFMASPYRTSWLAIRDSVRSTSFLSAFVGIFQA--FICAHRKVATKDHK 389

  Fly   266 LASFISGSSFAL------LSNRLTFMCFAIVTAIQVIWSQVCNTKDEKDSVLSAVRKIPWARLLI 324
            |..:.:|.:.||      ...|.....:.:..|...:|..:.|.     .:|..::.   |.:.:
plant   390 LVYWFAGGAAALSVMLEKKPRRSELALYVLPRAGDSLWEILVNR-----HLLPDIKN---AEVAL 446

  Fly   325 PCSLAYLVHIFFYHQRHLNEMA-------RSFIDCTCDNNGQRLLNLIGLPSVNAILQAVD--RT 380
            .|..  :..|.:|.:...:.||       |.|:.....|...:..:    .|..:.||.:|  :.
plant   447 FCGC--MGGIMYYLEYEPDTMAPFLRGLIRRFLASQISNPSSKYPH----SSSYSYLQTLDALKK 505

  Fly   381 PKT 383
            |||
plant   506 PKT 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31157NP_001097769.2 None
AT5G51150NP_199928.1 Tim17 <124..>175 CDD:280604
TMEM135_C_rich <360..431 CDD:292604 14/72 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D706534at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12459
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.