DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Slimp and TARS1

DIOPT Version :9

Sequence 1:NP_732958.1 Gene:Slimp / 318604 FlyBaseID:FBgn0051133 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_001245367.1 Gene:TARS1 / 6897 HGNCID:11572 Length:756 Species:Homo sapiens


Alignment Length:391 Identity:74/391 - (18%)
Similarity:138/391 - (35%) Gaps:113/391 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 GDKANENYVTLQPYMDFNKTFGERQFLEQSISSRGLDIRLETVLS--KYEKYKTHHAQLSKVAEE 91
            |..::.::.:|:...  .|...|:|..|:      |:::.||:|:  ||.|:|....        
Human   225 GGVSSNDFSSLEALC--KKIIKEKQAFER------LEVKKETLLAMFKYNKFKCRIL-------- 273

  Fly    92 RERVTKRLKELTKSGSSAVQLEELKEHGKSLRN--ELKALKQTLYPIEDDFIH-----------D 143
            .|:|......:.:.|    .|.:|. .|..:|:  ::||||          ||           |
Human   274 NEKVNTPTTTVYRCG----PLIDLC-RGPHVRHTGKIKALK----------IHKNSSTYWEGKAD 323

  Fly   144 YLHLPNLLHVQCPVGGEEKLLYRHGIPKSENKTTSH--LARQELVHFVDNNRYYLMEQAALFDVN 206
            ...|..:..:..|   :.|:|......:.|.|...|  :.|.:.::|     ::.:...:.|   
Human   324 METLQRIYGISFP---DPKMLKEWEKFQEEAKNRDHRKIGRDQELYF-----FHELSPGSCF--- 377

  Fly   207 AMQSLARYFVNHGHFIQTANPDFVRCVLLEANATPLSDYHL--VQEEHLQNKINT-AYLTGGASF 268
                    |:..|.:|..|..:|:|           |:|..  .||....|..|: .::|.| .:
Human   378 --------FLPKGAYIYNALIEFIR-----------SEYRKRGFQEVVTPNIFNSRLWMTSG-HW 422

  Fly   269 ESYLGAMTKLCVYPSVLPLRYVCC----------GRSYNRA-----------EADLYGPIPSLYT 312
            :.|...|....|...:..|:.:.|          .||:...           ..:|.|.:..|..
Human   423 QHYSENMFSFEVEKELFALKPMNCPGHCLMFDHRPRSWRELPLRLADFGVLHRNELSGALTGLTR 487

  Fly   313 AT--QTNAVQIFVATQTDNEADSQLEHILNLATDFYKALDIPFRISYATAADLTPAESIRAVIEV 375
            ..  |.:...||.|.:   :.:.:::..|:.....|......|:::.:|.     .|.....|||
Human   488 VRRFQQDDAHIFCAME---QIEDEIKGCLDFLRTVYSVFGFSFKLNLSTR-----PEKFLGDIEV 544

  Fly   376 Y 376
            :
Human   545 W 545

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SlimpNP_732958.1 serS 43..433 CDD:273066 72/377 (19%)
Seryl_tRNA_N 51..150 CDD:299883 26/113 (23%)
class_II_aaRS-like_core 194..433 CDD:294192 37/209 (18%)
TARS1NP_001245367.1 PLN02908 44..749 CDD:178496 74/391 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.