DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Slimp and SerRS

DIOPT Version :9

Sequence 1:NP_732958.1 Gene:Slimp / 318604 FlyBaseID:FBgn0051133 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_001259982.1 Gene:SerRS / 33518 FlyBaseID:FBgn0031497 Length:501 Species:Drosophila melanogaster


Alignment Length:447 Identity:94/447 - (21%)
Similarity:177/447 - (39%) Gaps:81/447 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 GERQFLEQSISSRGLDIRL-ETVLSKYEKYK--THHAQ--------LSKVAEERER--------- 94
            |....:.::...|..|:.| |||::|..:::  .|.|.        .|||..|:.:         
  Fly    14 GNPDLVRENQKKRFKDVALVETVIAKDTEWRQCRHRADNLNKVKNVCSKVIGEKMKKKEPVGAMS 78

  Fly    95 ------VTKRLKELTKSGSSAVQLEELKEHGKSLRNELKALKQTLYPIEDDFIHDYLHLPNLLHV 153
                  |||.|.|:.......:.:.::|:....:.:.:...:::|...|.........:.|.||.
  Fly    79 EDLPADVTKDLTEIVAETLQPLTVNQIKQLRVLIDDAMTENQKSLELAEQTRNTSLREVGNHLHE 143

  Fly   154 QCPVGGEEKLLYRHGIPKSENKTT------------SHLARQELVHFVD-----------NNRYY 195
            ..||..:|          .||:..            ||:   :|:..:|           ..|.|
  Fly   144 SVPVSNDE----------DENRVERTFGDCEKRGKYSHV---DLIVMIDGMNAEKGAVVSGGRGY 195

  Fly   196 LMEQAALFDVNAMQSLARYFVNHGHFIQTANPDFVRCVLLEANATPLSD-----YHLV---QEEH 252
            .:..||:|...|:...|.:.:....::....|.|:|..::: ....||.     |.:|   .|:.
  Fly   196 FLTGAAVFLEQALIQHALHLLYARDYVPLYTPFFMRKEVMQ-EVAQLSQFDEELYKVVGKGSEKA 259

  Fly   253 LQNKINTAYLTGGASFESYLGAMTKLCVYP-SVLPLRYVCCGRSYNRAEADLYG-PIPSLYTATQ 315
            .:..|:..||.  |:.|..:.|..:....| |.||::|......: |.|...:| ....::...|
  Fly   260 EEVGIDEKYLI--ATSEQPIAAYHRDEWLPESSLPIKYAGLSTCF-RQEVGSHGRDTRGIFRVHQ 321

  Fly   316 TNAVQIFVATQT-DNEADSQLEHILNLATDFYKALDIPFRISYATAADLTPAESIRAVIEVYAPS 379
            ...|:.||.|.. ||::...::.::..|..|.::|.||:|:....:..|..|.|.:..:|.:...
  Fly   322 FEKVEQFVLTSPHDNKSWEMMDEMIGNAEQFCQSLGIPYRVVNIVSGALNHAASKKLDLEAWFGG 386

  Fly   380 LQRYVCVGRISNYGDFVSKRILFSTRREKH----YDFLHMVGGPVLYTSRLIAALVE 432
            ...|..:...||..|:.::|:|....:.|.    .|::||:...:...:|:|.|::|
  Fly   387 SGAYRELVSCSNCLDYQARRLLVRFGQTKKMNAAVDYVHMLNATMCAATRVICAILE 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SlimpNP_732958.1 serS 43..433 CDD:273066 94/447 (21%)
Seryl_tRNA_N 51..150 CDD:299883 21/124 (17%)
class_II_aaRS-like_core 194..433 CDD:294192 59/254 (23%)
SerRSNP_001259982.1 PLN02678 3..476 CDD:215364 94/447 (21%)
Seryl_tRNA_N 3..111 CDD:280549 20/96 (21%)
SerRS_core 153..461 CDD:238393 66/298 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452775
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0172
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.