DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31131 and Muc55B

DIOPT Version :9

Sequence 1:NP_733243.2 Gene:CG31131 / 318603 FlyBaseID:FBgn0051131 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_001286561.1 Gene:Muc55B / 37057 FlyBaseID:FBgn0034294 Length:485 Species:Drosophila melanogaster


Alignment Length:298 Identity:103/298 - (34%)
Similarity:134/298 - (44%) Gaps:45/298 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 DTTTVATNPQETTGYFTGEVSTTTEK--SATEES--TTTAVDYSTTESSYVT-----STTDTLYS 123
            :|:...|.|..|:|  |....||.|.  |.|.|:  |||.|..||||:...|     |||:...|
  Fly   193 ETSPEPTVPTTTSG--TPVTVTTPEAPVSTTPEAPVTTTPVAPSTTETPVPTTPVAPSTTEAPVS 255

  Fly   124 TTTAWPEVTSTDAIDATESVALYSTTTSSPEAADSTTESNSDSTEYAESTLIYPDLSTGWQETTT 188
            ||...|..|:..|...||  |...||..:|    ||||:...:|..|.||...|..:|....:||
  Fly   256 TTPEAPVSTTPVAPSTTE--APVPTTPVAP----STTEAPVPTTPVAPSTTEAPVPTTPVAPSTT 314

  Fly   189 ETIQSSTGLQEST------TTEFMPSTTEFPESTTTLSSEFSEKELIKTTTEIEINPSTTELPES 247
            |....:|.:..||      ||...|||||.|..||.::...:|.. :.||   .:.|||||.|..
  Fly   315 EAPVPTTPVAPSTTEAPVPTTPVAPSTTEAPVPTTPVAPSTTEAP-VPTT---PVAPSTTEAPVP 375

  Fly   248 TTESADSTTEPNESTFALSTDQTTTETAETSTEELFSTTETQESTTSLLEIIATTPGVETTTSYL 312
            ||..|.||||         ....||..|.::||....||....|||.  ..:.|||...:||   
  Fly   376 TTPVAPSTTE---------APVPTTPVAPSTTEAPVPTTPVAPSTTE--APVPTTPVASSTT--- 426

  Fly   313 DAVIDSTEEESSTLSTPFGFNLTTTEIVETQVETTTPR 350
            :|.:.:|....||...|    :::|....|:..:||.|
  Fly   427 EAPVSTTPVAPSTTEAP----VSSTPESTTEAASTTER 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31131NP_733243.2 None
Muc55BNP_001286561.1 DUF725 52..170 CDD:283039
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.