DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31128 and CG34258

DIOPT Version :9

Sequence 1:NP_733000.1 Gene:CG31128 / 318601 FlyBaseID:FBgn0051128 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_001097648.1 Gene:CG34258 / 5740493 FlyBaseID:FBgn0085287 Length:165 Species:Drosophila melanogaster


Alignment Length:170 Identity:46/170 - (27%)
Similarity:73/170 - (42%) Gaps:33/170 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VSLCYIGLGGALK-----DLK------------EGKIAEPLCSNCNKIQRKCTVSHSGLFCKNKT 60
            |.|.||.|  |||     :||            :.:|:.|.|:||:  ..|...:::...|..:.
  Fly     5 VLLVYICL--ALKCGHPINLKNYYTSTTPFSSADHEISFPACANCS--SEKNFRTNTDFHCHFED 65

  Fly    61 DKEKILFSHSLAEKLYNLDECVPHKYNVTGPILDWCCLWSPKLGCQQLAGIYYQNQSRWRDTCEI 125
            |.   ....:..:...:..:|:|..:..|..|..:||.|||||||..|.|..:.::..:  :|:.
  Fly    66 DS---AIEENFGKWTNSYPDCLPDHFIATRKIKAYCCFWSPKLGCSALIGRKFYDKKIY--SCKT 125

  Fly   126 CLHSCICD-----EDTNGVVKCSPTAGCLAALGILGILLS 160
            |...|...     :|::|..|.|.:.|....|..|  |||
  Fly   126 CRRFCSATKQTYVDDSDGSDKVSESYGFSVLLAFL--LLS 163



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462402
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007611
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.