DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31128 and CG32219

DIOPT Version :9

Sequence 1:NP_733000.1 Gene:CG31128 / 318601 FlyBaseID:FBgn0051128 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_730469.1 Gene:CG32219 / 317922 FlyBaseID:FBgn0052219 Length:150 Species:Drosophila melanogaster


Alignment Length:79 Identity:30/79 - (37%)
Similarity:41/79 - (51%) Gaps:8/79 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 GLFCKNKTDKEKILFSHSLAEKLYNLDECVPHKYNVTGPILDWCCLWSPKLGCQQLAG-IYYQNQ 116
            |..| :|.|:..||...|..|..:  .||||:.:.:..||.::||.|||||||..|.. .|:.| 
  Fly    47 GFHC-HKDDQNSILRFASDEESAF--AECVPNCFEIKYPIQEYCCFWSPKLGCTILVNEKYFSN- 107

  Fly   117 SRWRDTCEICLHSC 130
               :|.|..|.:.|
  Fly   108 ---KDLCNNCKYFC 118



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462404
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007611
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.