DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wsck and TIE1

DIOPT Version :9

Sequence 1:NP_733018.1 Gene:Wsck / 318600 FlyBaseID:FBgn0046685 Length:791 Species:Drosophila melanogaster
Sequence 2:NP_005415.1 Gene:TIE1 / 7075 HGNCID:11809 Length:1138 Species:Homo sapiens


Alignment Length:755 Identity:173/755 - (22%)
Similarity:287/755 - (38%) Gaps:197/755 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 HYAVLASEKCFCANVLEPQEQQDEQLCNTRCLANKAQYC----------GGVGVHSYYSTILTKQ 129
            ||....|...:...|::|.|  :..|.|.|   .|..|.          ||.|.....:.:.|..
Human   483 HYRPQDSTMDWSTIVVDPSE--NVTLMNLR---PKTGYSVRVQLSRPGEGGEGAWGPPTLMTTDC 542

  Fly   130 PGP--------HHLRISNKTENSLTLSWNAYEARKLLLAGGAEAVLPNQLL-DNFLIK------- 178
            |.|        .|:..:::    |.:||:.             .::|..|: |.||::       
Human   543 PEPLLQPWLEGWHVEGTDR----LRVSWSL-------------PLVPGPLVGDGFLLRLWDGTRG 590

  Fly   179 AQVLKTYSSLPAFPQPEFMVQSTETQFELTDLHPATLYNISVRAMCKDAQVGQSEC---GQASIE 240
            .:..:..||    ||....:        ||.|.|.|.|.:.|:..         .|   |.||..
Human   591 QERRENVSS----PQARTAL--------LTGLTPGTHYQLDVQLY---------HCTLLGPASPP 634

  Fly   241 ATTEVGLPSPVPAQPKIL---SRTDRTVTI-----ELSPIRNDNGPLSKLLVIVEYVDNALSQPF 297
            |  .|.||...|..|:.|   :.:|..:.:     |..|     ||:||.:|.|:....|     
Human   635 A--HVLLPPSGPPAPRHLHAQALSDSEIQLTWKHPEALP-----GPISKYVVEVQVAGGA----- 687

  Fly   298 DAQLLGSWQQAQQDGVPYYIAAELDYDRPEDNRTRRFVVGDGKRY-----------GRFTNKPLD 351
                          |.|.:|    |.||||:..|....:....||           |.::|...:
Human   688 --------------GDPLWI----DVDRPEETSTIIRGLNASTRYLFRMRASIQGLGDWSNTVEE 734

  Fly   352 QPDAHVHISLGLVSTLEGVTKTMYSRGTHDQHVTSLDDFSYATFEKGQSSVVALAVTCVIFGSCL 416
            .       :||.....||..:.  ||..                |:|....:.|||...:..:||
Human   735 S-------TLGNGLQAEGPVQE--SRAA----------------EEGLDQQLILAVVGSVSATCL 774

  Fly   417 --LLSLIAYFYLRYKTCRGRRLT----GGNTHEMTLQTPIIERENNGYLVEDDPLPHSPENFKQQ 475
              |.:|:....:| ::|..||.|    .|:..|..||.      ::|.|.    |...|:...:.
Human   775 TILAALLTLVCIR-RSCLHRRRTFTYQSGSGEETILQF------SSGTLT----LTRRPKLQPEP 828

  Fly   476 LQQLVEGYERIPRNALRLNVNDVIGDGRFGEIITGKVSTNDFARDCTLHVLCLDDLNGTTQAQLL 540
            |...|..:|.|       ...|:||:|.||::|...:..:....:..:.:| .:..:........
Human   829 LSYPVLEWEDI-------TFEDLIGEGNFGQVIRAMIKKDGLKMNAAIKML-KEYASENDHRDFA 885

  Fly   541 RELRQLSQLKRQEHLLDFYGVSASPDWFYLIFEQQRM-SLKRKLVESRLMAPSPRL-------TS 597
            .||..|.:|....::::..|...:..:.|:..|.... :|...|.:||::...|..       ::
Human   886 GELEVLCKLGHHPNIINLLGACKNRGYLYIAIEYAPYGNLLDFLRKSRVLETDPAFAREHGTAST 950

  Fly   598 LSEQLVLQWIYELASAMNYLSSCQVVHRQLCSHSVFVTSDFKLKLSVFGPLPYMNIARQQPDH-- 660
            ||.:.:|::..:.|:.|.|||..|.:||.|.:.:|.|..:...|::.||      ::|.:..:  
Human   951 LSSRQLLRFASDAANGMQYLSEKQFIHRDLAARNVLVGENLASKIADFG------LSRGEEVYVK 1009

  Fly   661 -------NRWLAPEVLRHQHHHSTRSDVWSLACVAWECCALGGTPYANAVASNQQLLEAIRAAVR 718
                   .||:|.|.|.:. .::|:|||||...:.||..:||||||.....:  :|.|.:....|
Human  1010 KTMGRLPVRWMAIESLNYS-VYTTKSDVWSFGVLLWEIVSLGGTPYCGMTCA--ELYEKLPQGYR 1071

  Fly   719 PAQPAYVYGDLYQLLLNCWQLEPSERSSCEDVAFGVRQLM 758
            ..||.....::|:|:..||:..|.||.....:|..:.:::
Human  1072 MEQPRNCDDEVYELMRQCWRDRPYERPPFAQIALQLGRML 1111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WsckNP_733018.1 WSC 42..115 CDD:280068 11/49 (22%)
fn3 130..222 CDD:278470 22/107 (21%)
TyrKc 493..746 CDD:197581 69/269 (26%)
PTKc 497..750 CDD:270623 69/269 (26%)
TIE1NP_005415.1 ig 129..210 CDD:278476
EGF_CA 227..256 CDD:238011
EGF_2 315..344 CDD:285248
ig 356..441 CDD:278476
fn3 452..536 CDD:278470 14/57 (25%)
fn3 548..632 CDD:278470 22/121 (18%)
FN3 644..736 CDD:238020 26/126 (21%)
PTKc_Tie1 836..1132 CDD:270671 72/293 (25%)
TyrKc 839..1107 CDD:197581 71/284 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.