DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wsck and Pdgfrl

DIOPT Version :9

Sequence 1:NP_733018.1 Gene:Wsck / 318600 FlyBaseID:FBgn0046685 Length:791 Species:Drosophila melanogaster
Sequence 2:NP_081116.3 Gene:Pdgfrl / 68797 MGIID:1916047 Length:375 Species:Mus musculus


Alignment Length:298 Identity:55/298 - (18%)
Similarity:92/298 - (30%) Gaps:106/298 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   436 LTGGNTHEMTLQTPIIERENNGYLVEDDPLPHSPENFKQQLQQLVEGYERIPRNALRLNVNDVIG 500
            |..|.|.|:..:...:|.....||          :.||.. :..|:..||..:..|   ||....
Mouse    86 LLAGQTLELRCKGSKVEWSYPAYL----------DTFKDS-RLTVKQSERYGQLTL---VNSTAA 136

  Fly   501 D-GRFG---EIITGKVSTNDFARDCTLHVLCLDDLNGTTQAQLLRELRQLSQLKRQEHLLDFYGV 561
            | |.|.   ::..|.:...|.|:..:.::..      |.:.:|.                     
Mouse   137 DTGEFSCWEQLCNGYICRRDEAKTGSTYIFF------TEKGELF--------------------- 174

  Fly   562 SASPDWFYLIFEQQRMSLKRKLVESRLMAPSPRLTSLSEQLVLQWI--------YELASAMNYL- 617
            ..||.:|.:::....   ::.:|..|:.|||.::| |..:...:.|        |::.....|| 
Mouse   175 VPSPSYFDVVYLNPD---RQAVVPCRVTAPSAKVT-LHREFPAKEIPANGTDIVYDMKRGFVYLQ 235

  Fly   618 ------------------SSCQVVHRQL---------------CSHSVFVTSDFKLKLSVFGPLP 649
                              |...|.::.|               .|:.|....|..:..:|.|   
Mouse   236 PHSDHQGVVYCKAEAGGKSQISVKYQLLYVEVPSGPPSTTILASSNKVRGGDDISVLCTVLG--- 297

  Fly   650 YMNIARQQPD---HNRWLAPEVLRHQHHHSTRSDVWSL 684
                   :||   ..|||.|.  :......|..|.|.|
Mouse   298 -------EPDVEVEFRWLFPG--QKDERPVTIQDTWRL 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WsckNP_733018.1 WSC 42..115 CDD:280068
fn3 130..222 CDD:278470
TyrKc 493..746 CDD:197581 42/241 (17%)
PTKc 497..750 CDD:270623 40/237 (17%)
PdgfrlNP_081116.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..63
Ig 80..143 CDD:299845 18/70 (26%)
IG_like 83..>143 CDD:214653 18/70 (26%)
I-set 272..373 CDD:254352 15/67 (22%)
Ig 293..372 CDD:299845 12/46 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.