DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wsck and si:ch73-206d17.1

DIOPT Version :9

Sequence 1:NP_733018.1 Gene:Wsck / 318600 FlyBaseID:FBgn0046685 Length:791 Species:Drosophila melanogaster
Sequence 2:XP_689652.2 Gene:si:ch73-206d17.1 / 561155 ZFINID:ZDB-GENE-090313-143 Length:393 Species:Danio rerio


Alignment Length:383 Identity:81/383 - (21%)
Similarity:157/383 - (40%) Gaps:83/383 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   393 ATFEKGQSSVVALAVTCVI-FGSCLLLSLIAYFYLRYKTCRGRRLTGGNTHEMTLQTPIIERENN 456
            |.:::|...:..:.:..:: ..:.:::|.|.:.::. |....:::|..:::       :.|||: 
Zfish    16 ACYDEGSGPLAVIIIPSLLALSTLIVVSQIIWSFVT-KRSSAQKITSSSSN-------VNEREH- 71

  Fly   457 GYLVEDDPLPHS--PEN----FKQQLQQLVEGYERIPRNALRLNVNDVIGDGRFGEIITGKVSTN 515
               |:.|....|  |.|    .:..:|..:||.|             |:..||:|.|..|::..:
Zfish    72 ---VQLDAGIGSLRPANVLGPLELPVQCTLEGVE-------------VLQMGRYGPICMGQLKQD 120

  Fly   516 DFARDCTLHVLCLDDLNGTTQAQLLRELRQLSQLKRQEHLLDFY----GVSASPDWFYLIFEQQR 576
            :                 |:.|.:::.|:..|........:|..    .||...:...|:|.|.|
Zfish   121 N-----------------TSTAVMIKTLKDRSTQSESAEFMDLVLFHAAVSKHENIVKLLFCQTR 168

  Fly   577 MSLKRKLVESRLMAPSPRLTSL--------------SEQLVLQWIYELASAMNYL-SSCQVVHRQ 626
            .:....|:|:.:  |...|..|              ||:.|.....::|:.::|| |..:|:|..
Zfish   169 RTPMYLLLEASV--PGNLLNFLWSLREDRCGESSVFSEKSVFLVAKQIAAGLDYLHSHHRVIHGD 231

  Fly   627 LCSHSVFVTSDFKLKLS----VFGPLPYMNIARQQPDHN---RWLAPEVLRHQHHHSTRSDVWSL 684
            :.:.::.:.|.|.:|:|    .|.......:.|:| :.|   :|.|||.:. :...:.||||||.
Zfish   232 VAARNMLIGSAFSVKVSGLDFAFESRQKKKVDREQ-EANVPVKWQAPERMM-RLPLTDRSDVWSF 294

  Fly   685 ACVAWECCALGGTPYANAVASNQQLLEAIRAAVRPAQPAYVYGDLYQLLLNC--WQLE 740
            ..:.:|...||..||.:...|  ::|....|..|..:|......|:.|:..|  |..:
Zfish   295 GILLYEMITLGSPPYPDLDPS--EVLPRTLAHYRMKRPENCGAPLFDLIKYCCMWNFK 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WsckNP_733018.1 WSC 42..115 CDD:280068
fn3 130..222 CDD:278470
TyrKc 493..746 CDD:197581 63/276 (23%)
PTKc 497..750 CDD:270623 63/272 (23%)
si:ch73-206d17.1XP_689652.2 PKc_like 102..363 CDD:304357 64/285 (22%)
Pkinase_Tyr 102..362 CDD:285015 64/285 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.