DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wsck and PDGFRL

DIOPT Version :9

Sequence 1:NP_733018.1 Gene:Wsck / 318600 FlyBaseID:FBgn0046685 Length:791 Species:Drosophila melanogaster
Sequence 2:NP_001359002.1 Gene:PDGFRL / 5157 HGNCID:8805 Length:375 Species:Homo sapiens


Alignment Length:105 Identity:26/105 - (24%)
Similarity:39/105 - (37%) Gaps:30/105 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   567 WFYL----IFEQQRMSLKRK-------LVESRLMAPSPRLTSLSEQLVLQWIYELASAMNYLSSC 620
            |.|.    .|:..|:|:|:.       ||.|         ||........|: :|.|  .|:  |
Human   103 WSYPAYLDTFKDSRLSVKQNERYGQLTLVNS---------TSADTGEFSCWV-QLCS--GYI--C 153

  Fly   621 QVVHRQLCSHSVFVTSDFKLKLSVFGPLP-YMNIARQQPD 659
            :....:..|..:|.|.    |..:|.|.| |.::....||
Human   154 RKDEAKTGSTYIFFTE----KGELFVPSPSYFDVVYLNPD 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WsckNP_733018.1 WSC 42..115 CDD:280068
fn3 130..222 CDD:278470
TyrKc 493..746 CDD:197581 26/105 (25%)
PTKc 497..750 CDD:270623 26/105 (25%)
PDGFRLNP_001359002.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 22..64
IG_like 83..145 CDD:214653 11/50 (22%)
Ig 293..372 CDD:386229
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.