DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wsck and PDGFRL

DIOPT Version :10

Sequence 1:NP_733018.1 Gene:Wsck / 318600 FlyBaseID:FBgn0046685 Length:791 Species:Drosophila melanogaster
Sequence 2:NP_006198.1 Gene:PDGFRL / 5157 HGNCID:8805 Length:375 Species:Homo sapiens


Alignment Length:105 Identity:26/105 - (24%)
Similarity:39/105 - (37%) Gaps:30/105 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   567 WFYL----IFEQQRMSLKRK-------LVESRLMAPSPRLTSLSEQLVLQWIYELASAMNYLSSC 620
            |.|.    .|:..|:|:|:.       ||.|         ||........|: :|.|  .|:  |
Human   103 WSYPAYLDTFKDSRLSVKQNERYGQLTLVNS---------TSADTGEFSCWV-QLCS--GYI--C 153

  Fly   621 QVVHRQLCSHSVFVTSDFKLKLSVFGPLP-YMNIARQQPD 659
            :....:..|..:|.|.    |..:|.|.| |.::....||
Human   154 RKDEAKTGSTYIFFTE----KGELFVPSPSYFDVVYLNPD 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WsckNP_733018.1 WSC 42..115 CDD:460348
fn3 130..222 CDD:394996
PTKc 497..750 CDD:270623 26/105 (25%)
PDGFRLNP_006198.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 22..64
IG_like 83..145 CDD:214653 11/50 (22%)
Ig 278..372 CDD:472250
Ig strand B 289..293 CDD:409404
Ig strand C 304..308 CDD:409404
Ig strand E 340..344 CDD:409404
Ig strand F 354..359 CDD:409404
Ig strand G 367..370 CDD:409404
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.