DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wsck and FER

DIOPT Version :9

Sequence 1:NP_733018.1 Gene:Wsck / 318600 FlyBaseID:FBgn0046685 Length:791 Species:Drosophila melanogaster
Sequence 2:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster


Alignment Length:280 Identity:68/280 - (24%)
Similarity:121/280 - (43%) Gaps:39/280 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   488 RNALRLNVNDV-----IGDGRFGEIITGKVSTNDFARDCTLHVLCLDDLNGTTQAQLLRELRQLS 547
            |....|:.:||     ||.|.||::...|:.:...  |..:.. |...|....:.:.|:|.|   
  Fly  1053 RERWELSNDDVVLLERIGRGNFGDVYKAKLKSTKL--DVAVKT-CRMTLPDEQKRKFLQEGR--- 1111

  Fly   548 QLKRQEH--LLDFYGVSASPDWFYLIFEQQRMSLKRKLVESRLMAPSPRLTSLSEQLVLQWIYEL 610
            .||:.:|  ::...|:........::.|   :.|...|: :.|...|..||:..:..:.:   :.
  Fly  1112 ILKQYDHPNIVKLIGICVQKQPIMIVME---LVLGGSLL-TYLRKNSNGLTTRQQMGMCR---DA 1169

  Fly   611 ASAMNYLSSCQVVHRQLCSHSVFVTSDFKLKLSVFGPLPYMNIARQQPDH----------NRWLA 665
            |:.|.||.|...:||.|.:.:..|..:..:|:|.||      ::|::.::          .:|.|
  Fly  1170 AAGMRYLESKNCIHRDLAARNCLVDLEHSVKISDFG------MSREEEEYIVSDGMKQIPVKWTA 1228

  Fly   666 PEVLRHQHHHSTRSDVWSLACVAWECCALGGTPYANAVASNQQLLEAIRAAVRPAQPAYVYGDLY 730
            ||.|....:.|. .||||...:.||..:.|.|||:.  .:|.:..|.|....|...|.....::|
  Fly  1229 PEALNFGKYTSL-CDVWSYGILMWEIFSKGDTPYSG--MTNSRARERIDTGYRMPTPKSTPEEMY 1290

  Fly   731 QLLLNCWQLEPSERSSCEDV 750
            :|:|.||..:...|...:::
  Fly  1291 RLMLQCWAADAESRPHFDEI 1310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WsckNP_733018.1 WSC 42..115 CDD:280068
fn3 130..222 CDD:278470
TyrKc 493..746 CDD:197581 67/269 (25%)
PTKc 497..750 CDD:270623 66/269 (25%)
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224
TyrKc 1063..1311 CDD:197581 65/270 (24%)
PTKc_Fes_like 1067..1315 CDD:270637 64/266 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24418
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.