DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wsck and fgfrl1a

DIOPT Version :10

Sequence 1:NP_733018.1 Gene:Wsck / 318600 FlyBaseID:FBgn0046685 Length:791 Species:Drosophila melanogaster
Sequence 2:NP_956670.1 Gene:fgfrl1a / 393347 ZFINID:ZDB-GENE-040128-2 Length:483 Species:Danio rerio


Alignment Length:189 Identity:42/189 - (22%)
Similarity:64/189 - (33%) Gaps:48/189 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   604 LQWIYELASAMNYLSSC---------QVVHRQLCSHSVFVTSDFKLKLSVFGPLPYM-------- 651
            |.||......:.:::.|         ::.|||    :|.:....||:..|.|..|.:        
Zfish     3 LLWIVFFIFDIIFITDCARGPPRVAEKIAHRQ----TVRIGRTMKLQCPVEGDPPPLIMWTKDGR 63

  Fly   652 NIARQQPDHNRWLAPEVLRH--QHHHSTRSDVWSLACVAWECCALGGTPYANAVASNQQLL---- 710
            ||      |:.|:...||:.  :.......|..:..|.|        |....:|..|..|:    
Zfish    64 NI------HSGWMRFRVLQQALRIKEVEADDAGTFICKA--------TNGFGSVNINYTLIVIDD 114

  Fly   711 -EAIRAAVRPAQPAYVYGDLYQLLLNCWQLEPS---ERSSCEDVAFGVRQLMT---SPR 762
             .|.|...|||.......||...|:.....:|:   :|.....|...||...|   :||
Zfish   115 SSAGREGARPAGETEYSTDLTGKLVRPRFTQPAKMRKRVIARPVGSSVRLKCTASGNPR 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WsckNP_733018.1 WSC 42..115 CDD:460348
fn3 130..222 CDD:394996
PTKc 497..750 CDD:270623 36/172 (21%)
fgfrl1aNP_956670.1 I-set 32..111 CDD:400151 22/96 (23%)
Ig strand B 42..46 CDD:409390 2/3 (67%)
Ig strand C 55..59 CDD:409390 0/3 (0%)
Ig strand E 77..81 CDD:409390 0/3 (0%)
Ig strand F 91..96 CDD:409390 1/4 (25%)
Ig strand G 104..107 CDD:409390 0/2 (0%)
IgI_2_FGFRL1-like 141..232 CDD:409442 8/33 (24%)
Ig strand A 141..144 CDD:409442 0/2 (0%)
Ig strand A' 152..157 CDD:409442 1/4 (25%)
Ig strand B 161..169 CDD:409442 3/7 (43%)
Ig strand C 175..180 CDD:409442
Ig strand C' 183..185 CDD:409442
Ig strand D 191..194 CDD:409442
Ig strand E 198..203 CDD:409442
Ig strand F 212..219 CDD:409442
Ig strand G 222..232 CDD:409442
Ig 240..348 CDD:472250
Ig strand B 258..262 CDD:409363
Ig strand C 271..275 CDD:409363
Ig strand E 315..319 CDD:409363
Ig strand F 329..334 CDD:409363
Ig strand G 342..345 CDD:409363
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.