DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wsck and Ack

DIOPT Version :9

Sequence 1:NP_733018.1 Gene:Wsck / 318600 FlyBaseID:FBgn0046685 Length:791 Species:Drosophila melanogaster
Sequence 2:NP_647859.1 Gene:Ack / 38489 FlyBaseID:FBgn0028484 Length:1073 Species:Drosophila melanogaster


Alignment Length:260 Identity:73/260 - (28%)
Similarity:115/260 - (44%) Gaps:29/260 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   499 IGDGRFGEIITGKVSTNDFAR--DCTLHVLCLDDLNGTTQAQLLRE-LRQLSQLKRQEH--LLDF 558
            :|||.||.:..|:.|.:...:  ...:.||..|:|   ||..::.: .|::..:...:|  |:..
  Fly   129 LGDGSFGVVRRGEWSASPAGKVIPVAVKVLKSDNL---TQPGIIDDFFREVQAMHALDHANLVRL 190

  Fly   559 YGVSASPDWFYLIFEQQRMSLKRKLVESRLMAPSPRLTSLSEQLVLQWIYELASAMNYLSSCQVV 623
            |||..|.....:....:|.||...|      ....|.|||:  ::..|..::.:.|.||...:.:
  Fly   191 YGVVLSQPMMMITELAERGSLLDTL------RKQCRHTSLT--IIWNWSVQIVTGMAYLEQKRFL 247

  Fly   624 HRQLCSHSVFVTSDFKLKLSVFG---PLPYMNIARQQPDHNR----WLAPEVLR-HQHHHSTRSD 680
            ||.|...:|.:.:..|:|:..||   .||..:......:|.:    |.|||.|| .|..|:  ||
  Fly   248 HRDLACRNVLLAAGNKIKIGDFGLMRALPQEDDCYVMSEHKKVPFPWCAPESLRFRQFSHA--SD 310

  Fly   681 VWSLACVAWECCALGGTPYANAVASNQQLLEAI-RAAVRPAQPAYVYGDLYQLLLNCWQLEPSER 744
            .|......||..:.|..|:..  .:..|:|..| |...|..||.....|:|.::|.||...|:||
  Fly   311 TWMFGVTLWEMFSFGEDPWVG--LNGSQILRKIDREGERLHQPDACPPDVYAMMLQCWDKTPAER 373

  Fly   745  744
              Fly   374  373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WsckNP_733018.1 WSC 42..115 CDD:280068
fn3 130..222 CDD:278470
TyrKc 493..746 CDD:197581 73/260 (28%)
PTKc 497..750 CDD:270623 73/260 (28%)
AckNP_647859.1 SAM_TNK-like 14..75 CDD:188938
PTKc_Ack_like 128..385 CDD:270636 73/260 (28%)
UBA_TNK1 1031..1070 CDD:270513
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24418
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.