DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wsck and KDR

DIOPT Version :9

Sequence 1:NP_733018.1 Gene:Wsck / 318600 FlyBaseID:FBgn0046685 Length:791 Species:Drosophila melanogaster
Sequence 2:NP_002244.1 Gene:KDR / 3791 HGNCID:6307 Length:1356 Species:Homo sapiens


Alignment Length:440 Identity:102/440 - (23%)
Similarity:176/440 - (40%) Gaps:127/440 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   396 EKGQSSVVALAVTCVIFGSCLLLSLIAYFYLRYKTCRGRRLTGGNTHEMTLQTPIIERENNGYL- 459
            ||....::.|..|.||   .:...|:....||    ..:|..||.     |:|        ||| 
Human   759 EKTNLEIIILVGTAVI---AMFFWLLLVIILR----TVKRANGGE-----LKT--------GYLS 803

  Fly   460 --VEDDPLPHSPENFKQQLQQLVEGYERIPRNAL-------RLNVNDVIGDGRFGEIITGKVSTN 515
              ::.|.||            |.|..||:|.:|.       ||.:...:|.|.||::|.......
Human   804 IVMDPDELP------------LDEHCERLPYDASKWEFPRDRLKLGKPLGRGAFGQVIEADAFGI 856

  Fly   516 DFARDC-TLHVLCLDDLNGTTQAQ---LLRELRQLSQLKRQEHLLDFYGVSASPDWFYLI----- 571
            |....| |:.|..|.:  |.|.::   |:.||:.|..:....::::..|....|....::     
Human   857 DKTATCRTVAVKMLKE--GATHSEHRALMSELKILIHIGHHLNVVNLLGACTKPGGPLMVIVEFC 919

  Fly   572 -------------------------FEQQR-------MSLKRKL---VESRLMAPS-----PRLT 596
                                     |.|.:       :.|||:|   ..|:..|.|     ..|:
Human   920 KFGNLSTYLRSKRNEFVPYKTKGARFRQGKDYVGAIPVDLKRRLDSITSSQSSASSGFVEEKSLS 984

  Fly   597 SLSEQ----------LVLQ----WIYELASAMNYLSSCQVVHRQLCSHSVFVTSDFKLKLSVFGP 647
            .:.|:          |.|:    :.:::|..|.:|:|.:.:||.|.:.::.::....:|:..|| 
Human   985 DVEEEEAPEDLYKDFLTLEHLICYSFQVAKGMEFLASRKCIHRDLAARNILLSEKNVVKICDFG- 1048

  Fly   648 LPYMNIAR---QQPDHNR---------WLAPEVLRHQHHHSTRSDVWSLACVAWECCALGGTPYA 700
                 :||   :.||:.|         |:|||.: ....::.:|||||...:.||..:||.:||.
Human  1049 -----LARDIYKDPDYVRKGDARLPLKWMAPETI-FDRVYTIQSDVWSFGVLLWEIFSLGASPYP 1107

  Fly   701 NAVASNQQLLEAIRAAVRPAQPAYVYGDLYQLLLNCWQLEPSERSSCEDV 750
             .|..:::....::...|...|.|...::||.:|:||..|||:|.:..::
Human  1108 -GVKIDEEFCRRLKEGTRMRAPDYTTPEMYQTMLDCWHGEPSQRPTFSEL 1156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WsckNP_733018.1 WSC 42..115 CDD:280068
fn3 130..222 CDD:278470
TyrKc 493..746 CDD:197581 75/327 (23%)
PTKc 497..750 CDD:270623 74/327 (23%)
KDRNP_002244.1 Ig 41..109 CDD:299845
IG_like 231..324 CDD:214653
Ig1_VEGFR 239..326 CDD:143270
IG_like 340..417 CDD:214653
Ig2_VEGFR-2 348..417 CDD:143272
Ig_2 551..661 CDD:290606
IG 565..661 CDD:214652
I-set 667..754 CDD:254352
IGc2 680..744 CDD:197706
PTKc_VEGFR2 826..1167 CDD:270681 76/341 (22%)
Pkinase_Tyr 834..1160 CDD:285015 75/333 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1274..1318
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.