DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wsck and Ack-like

DIOPT Version :9

Sequence 1:NP_733018.1 Gene:Wsck / 318600 FlyBaseID:FBgn0046685 Length:791 Species:Drosophila melanogaster
Sequence 2:NP_001260935.1 Gene:Ack-like / 36442 FlyBaseID:FBgn0263998 Length:1495 Species:Drosophila melanogaster


Alignment Length:321 Identity:81/321 - (25%)
Similarity:141/321 - (43%) Gaps:51/321 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   485 RIPRN-----ALRLNVNDVIGDGRFGEIITGKVSTNDFARDCTLHVLCLDDLNGTTQAQLLRELR 544
            ::|.|     |..::||..:|.|.||.:..|..|..:......:..||.:.:. :...:.|:|..
  Fly   120 KVPNNKHIIPADSISVNKQLGTGEFGIVQQGVWSNGNERIQVAIKCLCRERMQ-SNPMEFLKEAA 183

  Fly   545 QLSQLKRQEHLLDFYGVSASPDWFYLIFEQQRM-SLKRKLVESRLMAPSPRLTSLSEQLVLQWIY 608
            .:..:: .|:::..|||..:.|...|:.|...: ||...|.:|.|     |::.|:...:.::..
  Fly   184 IMHSIE-HENIVRLYGVVLATDSLMLVTELAHLRSLLECLKDSGL-----RVSFLTIPTLCEFAL 242

  Fly   609 ELASAMNYLSSCQVVHRQLCSHSVFVTSDFKLKLSVFGPLPYMNIARQQPDHN---------RWL 664
            ::.:.|.||...:::||.|.:.::.|.|..|:|:|.||....:.:.:.....|         .|.
  Fly   243 QICNGMRYLEQKRLIHRDLAARNILVFSKDKVKISDFGLSRALGVGKDYYKTNFNVNLKLPIAWC 307

  Fly   665 APEVLRHQHHHSTRSDVWSLACVAWECCALGGTPYANAVASNQQLLEAIRAA--VRPAQPAYVYG 727
            |||.:.:. ..:..||||:.....||..:.|..|:  |..:..|:||||.|.  .|..||.....
  Fly   308 APECINYL-RFTNASDVWAFGVCLWEMFSYGFQPW--AALTGLQILEAIDAPNYQRLEQPDCCPS 369

  Fly   728 DLYQLLLNCWQLEPSERSSCEDVAFGVRQLMTSPRHALSFDRVAGGLDTLPPYLP-QLEAV 787
            :.|.|::.|||.:.::|                ||....:|:       ||...| ||:||
  Fly   370 EYYTLMMKCWQDDAAKR----------------PRFGEIYDQ-------LPDMKPEQLKAV 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WsckNP_733018.1 WSC 42..115 CDD:280068
fn3 130..222 CDD:278470
TyrKc 493..746 CDD:197581 68/264 (26%)
PTKc 497..750 CDD:270623 66/264 (25%)
Ack-likeNP_001260935.1 SAM_TNK-like 4..65 CDD:188938
STYKc 133..396 CDD:214568 71/295 (24%)
PTKc_Ack_like 137..398 CDD:270636 70/293 (24%)
SH3 400..454 CDD:214620 5/8 (63%)
CRIB 486..525 CDD:238077
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24418
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.