DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wsck and Y50D4B.6

DIOPT Version :9

Sequence 1:NP_733018.1 Gene:Wsck / 318600 FlyBaseID:FBgn0046685 Length:791 Species:Drosophila melanogaster
Sequence 2:NP_503375.2 Gene:Y50D4B.6 / 3565593 WormBaseID:WBGene00021745 Length:421 Species:Caenorhabditis elegans


Alignment Length:435 Identity:90/435 - (20%)
Similarity:163/435 - (37%) Gaps:125/435 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   410 VIFGSCLLLSLIAYFYLRYKTC--------RGRRLTGGNTHEMTLQTPIIERENNGYLVEDDPLP 466
            |||...::::|...||..:|..        ..|.|..|..|..:.:||...|||...|..::   
 Worm     8 VIFYCIVVIALSVLFYYVWKFYYLRKEEHEETRSLESGIIHSSSQKTPSSVRENESLLQANE--- 69

  Fly   467 HSPENFKQQLQQLVEGYERIPRNAL----------RLNVN-------DVIGDGRFGEII------ 508
                      :.:..|.|..|.||:          .::||       ..:|:|.:|::.      
 Worm    70 ----------ENVPIGLETEPINAIIKNLKFDERFEIDVNKFSFYNLSFLGNGYYGKVFKERMHK 124

  Fly   509 ---TGKVSTNDF---------ARD-------C-TLHVLCLDDLNGTTQAQLLRELRQ-----LSQ 548
               .|..|.|..         ..|       | .|:|:|:...:....| |:|.:|.     :|:
 Worm   125 KQKNGLDSENSLEVAVKRALRPEDPSEQQLMCEELNVMCVVGKHPNILA-LIRWIRTNEILIVSE 188

  Fly   549 LKRQEHLLDFYGVSASPDWFYLIFEQQRMSLKRKLV----ESRLMAPSPRLTSLSEQLVLQWIYE 609
            ...:..|:::             ...:|....:.:|    ..||:.|:.         :|.:.::
 Worm   189 FVEKGDLVEY-------------LRARRRYFNKDIVCVEDNGRLLCPTD---------LLSFAFQ 231

  Fly   610 LASAMNYLSSCQVVHRQLCSHSVFVTSDFKLKLSVFGPLPYMNIARQQPDHN------------R 662
            :|:.|.:|.:...|||.|...:|||..:..::::.||      :||...:..            :
 Worm   232 IANGMKFLGNVACVHRDLALRNVFVKRNRIIRIADFG------LARWHENKEYYRKKTDVGFPMK 290

  Fly   663 WLAPEVLRHQHHH-----STRSDVWSLACVAWECCALGGTPYANAVASN---QQLLEAIRAAVRP 719
            |||||....:...     .::||:||.....:|..:||.:||.......   |.|::.:|...:.
 Worm   291 WLAPECFEFEQERENIKFDSKSDIWSYGVCLYEIFSLGVSPYEGLDFRPDYFQGLMKYVRDGNQL 355

  Fly   720 AQPAYVYGDLYQLLLNCWQLEPSER---SSCEDVAFGVRQLMTSP 761
            ..|.:....:|:.:.:||.|.|.:|   |.|.|....:.|.::.|
 Worm   356 PSPEHGSDKIYEFMQSCWNLNPDKRPVFSECRDFFQKLLQQVSKP 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WsckNP_733018.1 WSC 42..115 CDD:280068
fn3 130..222 CDD:278470
TyrKc 493..746 CDD:197581 63/317 (20%)
PTKc 497..750 CDD:270623 63/310 (20%)
Y50D4B.6NP_503375.2 PTKc 109..391 CDD:270623 64/310 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3801
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.