DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wsck and Lar

DIOPT Version :9

Sequence 1:NP_733018.1 Gene:Wsck / 318600 FlyBaseID:FBgn0046685 Length:791 Species:Drosophila melanogaster
Sequence 2:NP_001260594.1 Gene:Lar / 35259 FlyBaseID:FBgn0000464 Length:2032 Species:Drosophila melanogaster


Alignment Length:283 Identity:67/283 - (23%)
Similarity:113/283 - (39%) Gaps:54/283 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 LANKAQYCGGVGVHSYYSTILTK-QPGPHHLRISNKTENSLTLSWNAYEARKLLLAGGAEAVLPN 169
            :|..|::..|:|..|...|:..| :..|.:||..:.:.:|:||||:.                |.
  Fly  1081 VAIAARFKNGLGRLSEKVTVR
IKPEDVPLNLRAHDVSTHSMTLSWSP----------------PI 1129

  Fly   170 QLLD-NFLIKAQVLKTYSSLPAF------PQPEFMVQSTETQFELTDLHPATLYNISVRAMCKDA 227
            :|.. |:.|....:|.:.....|      |:.|.:::.......:.:|.|.|.||::|.|:..| 
  Fly  1130 RLTPVNYKISFDAMKVFVDSQGFSQTQIVPKREIILKHYVKTHTINELSPFTTYNVNVSAIPSD- 1193

  Fly   228 QVGQSECGQASIEATTEVGLPSPVPAQPKILSRTD-RTVTIELSPIRNDNGPLSK--LLVIVEYV 289
               .|......|..||::..|.|: .:|......: ..:.:.|.....:.||:|.  |:|:.|..
  Fly  1194 ---YSYRPPTKITVTTQMAAPQPM-VKPDFYGVVNGEEILVILPQASEEYGPISHYYLVVVPEDK 1254

  Fly   290 DNALSQP---FDAQLLGSWQQAQQDGVPYYIAAELDYDRPEDNRTRRFVVGDGKRYGRFTNKPL- 350
            .|....|   ....||....:.::...| ||||:.    |:.:....|.:|.|..|..|||:.| 
  Fly  1255 SNLHKIPDQFLTDDLLPGRNKPERPNAP-YIAAKF----PQRSIPFTFHLGSGDDYHNFTNRKLE 1314

  Fly   351 -------------DQPDAHVHIS 360
                         |.|..|::.|
  Fly  1315 REKRYRIFVRAVVDTPQKHLYTS 1337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WsckNP_733018.1 WSC 42..115 CDD:280068 2/8 (25%)
fn3 130..222 CDD:278470 22/98 (22%)
TyrKc 493..746 CDD:197581
PTKc 497..750 CDD:270623
LarNP_001260594.1 Ig 35..129 CDD:299845
I-set 36..129 CDD:254352
IG_like 146..227 CDD:214653
Ig 159..228 CDD:299845
I-set 234..318 CDD:254352
Ig3_RPTP_IIa_LAR_like 249..317 CDD:143216
fn3 324..404 CDD:278470
FN3 423..514 CDD:238020
FN3 520..610 CDD:238020
FN3 616..707 CDD:238020
FN3 712..810 CDD:238020
FN3 832..907 CDD:238020
FN3 914..1005 CDD:238020
FN3 1012..1101 CDD:238020 6/19 (32%)
fn3 1106..1198 CDD:278470 25/111 (23%)
PTPc 1476..1731 CDD:214550
PTPc 1503..1731 CDD:238006
PTPc 1763..2022 CDD:214550
PTPc 1791..2022 CDD:238006
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4228
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.