DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wsck and Ptp36E

DIOPT Version :9

Sequence 1:NP_733018.1 Gene:Wsck / 318600 FlyBaseID:FBgn0046685 Length:791 Species:Drosophila melanogaster
Sequence 2:NP_001286033.1 Gene:Ptp36E / 35091 FlyBaseID:FBgn0267486 Length:682 Species:Drosophila melanogaster


Alignment Length:252 Identity:46/252 - (18%)
Similarity:83/252 - (32%) Gaps:123/252 - (48%)


- Green bases have known domain annotations that are detailed below.


  Fly   456 NGYLVEDDPLPHSPENFKQQLQQLVEGYERIPRNALRLNVNDVIGDGRFGEIITGKVSTNDFARD 520
            |.|:|...|           :::.|:.|.|:   ..:.|::.::       ::|   .|.|||: 
  Fly   168 NAYIVTQGP-----------VEETVQAYWRM---VWQENISAIV-------MLT---KTFDFAK- 207

  Fly   521 CTLHVLC---------LDDLNGTTQAQLLRELRQLSQLKRQEHLLDFYGVSASPDWFYLIFEQQR 576
                |:|         :.:..|.....::||          |.|.:|:         ...|...:
  Fly   208 ----VMCHQYWPPNMEVHEQYGDIFINIVRE----------EQLANFH---------IRTFRLYK 249

  Fly   577 MSLKRKLVESRLMAPSPRLTSLSEQLVLQWIYELASAMNYLSSCQ-------------------- 621
            |:.|:::.:              |:|:||:.|    ...|..||.                    
  Fly   250 MNEKQEVTD--------------ERLILQFHY----TEWYSHSCPFSNALLEFRRRVRLVVGNII 296

  Fly   622 ----------VVHRQLCS-----HSVFVTSDFKLKL-------SVFGPLPYMNIARQ 656
                      :||   ||     ..|:::.|..|:|       :|||   |:...||
  Fly   297 KDEDDMRGPILVH---CSDGGGRSGVYMSIDANLELAEEEECFNVFG---YLKKLRQ 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WsckNP_733018.1 WSC 42..115 CDD:280068
fn3 130..222 CDD:278470
TyrKc 493..746 CDD:197581 39/215 (18%)
PTKc 497..750 CDD:270623 38/211 (18%)
Ptp36ENP_001286033.1 Y_phosphatase 125..368 CDD:395053 46/252 (18%)
Y_phosphatase 428..671 CDD:395053
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4228
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.