DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wsck and styk1b

DIOPT Version :9

Sequence 1:NP_733018.1 Gene:Wsck / 318600 FlyBaseID:FBgn0046685 Length:791 Species:Drosophila melanogaster
Sequence 2:NP_001292494.1 Gene:styk1b / 324714 ZFINID:ZDB-GENE-030131-3435 Length:447 Species:Danio rerio


Alignment Length:257 Identity:61/257 - (23%)
Similarity:105/257 - (40%) Gaps:23/257 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   519 RDCTLHVLCLDDLNGTTQAQLLRELRQLSQLKRQEHLLDFYGV-SASPDWFYLIFEQQRMSLKRK 582
            |:..|.|| .|..:.......|.....||||.....|.:..|| |.......:|.|.:...|...
Zfish   171 RNVVLRVL-KDSASNQESQSFLGFAAFLSQLGPHPFLPELLGVISLRAPLITVIEEMENRDLLGF 234

  Fly   583 LVESRLMAPSP-RLTSLSEQLVLQWIYELASAMNYLSSCQVVHRQLCSHSVFVTSDFKLKLSVFG 646
            |...|.....| .:..::|:.:......:|||:::|....:.|..|.:.:|.|:.....||....
Zfish   235 LWRCRQDNVGPDGMCQMTEKKIFNMASHVASALDFLHGKDLHHCNLKARNVLVSRICTAKLWGLD 299

  Fly   647 PLPYMNIA-----RQQPDHNRWLAPEVLRHQHHHSTRSDVWSLACVAWECCALGGTPYA----NA 702
            .| |:..:     .:.|...:|.|||:|. :...:.:||:||...:.:|...||..|:|    ..
Zfish   300 DL-YVRTSGSGNYSEDPGRKKWQAPELLA-KRPSTPKSDIWSFGLLLYEMVTLGEVPFAEIPVKE 362

  Fly   703 VASNQQLLEAIRAAVRPAQPAYVYGDLYQLLLNCWQLEPSERSSCEDVAFGVRQLMTSPRHA 764
            :..:.|.::.||      :|......||.::.:|...:..:|.|..:|.   |:|.:..:.|
Zfish   363 LLQHHQRVKPIR------KPNNCSNSLYSIIKSCCHWKEQDRPSLAEVR---RKLQSGEKSA 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WsckNP_733018.1 WSC 42..115 CDD:280068
fn3 130..222 CDD:278470
TyrKc 493..746 CDD:197581 56/237 (24%)
PTKc 497..750 CDD:270623 57/241 (24%)
styk1bNP_001292494.1 PKc_like 164..409 CDD:304357 59/249 (24%)
Pkinase_Tyr 164..408 CDD:285015 59/248 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.