DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wsck and Ptprm

DIOPT Version :9

Sequence 1:NP_733018.1 Gene:Wsck / 318600 FlyBaseID:FBgn0046685 Length:791 Species:Drosophila melanogaster
Sequence 2:XP_038939045.1 Gene:Ptprm / 29616 RGDID:620776 Length:1531 Species:Rattus norvegicus


Alignment Length:326 Identity:83/326 - (25%)
Similarity:129/326 - (39%) Gaps:82/326 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 TYSSLPAF-PQPEFMVQS-------TETQFELTDLHPATLYNISVRAMCKDAQVGQSECGQASIE 240
            ||.::.:| |:.:...||       .||.|....|:|.|.|:.::|     |...:.....|:.:
  Rat   535 TYKAVSSFDPEIDLSNQSGRVSKLGNETHFLFFGLYPGTTYSFTIR-----ASTAKGFGPPATNQ 594

  Fly   241 ATTEVGLPSPVPA----QPKILSRTDRTVTIELSPIRNDNGPLSKLLVIVE-----------YVD 290
            .||::..|| :||    .|  |::||.|||:.|.|.::...|:|...::||           .:.
  Rat   595 FTTKISAPS-MPAYEFETP--LNQTDNTVTVLLKPAQSRGAPVSVYQIVVEEERPRRTKKTTEIL 656

  Fly   291 NALSQPF---DAQLLGSWQQAQQDGVPYYIAAELDYDRPEDN--RTRRFVVGDGKRYGRFTNKPL 350
            .....|.   :|.:|.|         .||.|||.    |.|:  ..:.|.:||.|.|..:.|.||
  Rat   657 KCYPVPIHFQNASILNS---------QYYFAAEF----PADSLQAAQPFTIGDNKTYNGYWNTPL 708

  Fly   351 DQPDAHVHISLGLVSTLEGVTK------------------TMYSR---GTHDQHVT-SLDDFSYA 393
             .|.....|.....|...|.||                  |.|.|   ...|..:| ::......
  Rat   709 -LPHKSYRIYYQAASRANGETKIDCVRVATKAAIIVTQLTTPYIRIAPAAGDGQLTGAVTPKPVP 772

  Fly   394 TFEKGQSSVVALAVTCVIFGSCLLLSLIAYFYL-----RYKTCRGRRLTGGNT-HEMTLQTPIIE 452
            ..|||....|.:|  .||.|  :||.:|.:..:     :.|..:.|:.|..:| .|||:....::
  Rat   773 EPEKGTDHTVKIA--GVIAG--ILLFVIIFLGVVLVMKKRKLAKKRKETMSSTRQEMTVMVNSMD 833

  Fly   453 R 453
            :
  Rat   834 K 834

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WsckNP_733018.1 WSC 42..115 CDD:280068
fn3 130..222 CDD:278470 13/45 (29%)
TyrKc 493..746 CDD:197581
PTKc 497..750 CDD:270623
PtprmXP_038939045.1 FN3 298..377 CDD:214495
FN3 399..493 CDD:238020
fn3 515..590 CDD:394996 15/59 (25%)
R-PTPc-M-1 946..1235 CDD:350481
R-PTPc-M-2 1321..1526 CDD:350483
MAM 42..198 CDD:214533
ig 208..290 CDD:395002
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 55 1.000 Domainoid score I10839
eggNOG 1 0.900 - - E2759_KOG4228
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.