DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wsck and Ptpra

DIOPT Version :9

Sequence 1:NP_733018.1 Gene:Wsck / 318600 FlyBaseID:FBgn0046685 Length:791 Species:Drosophila melanogaster
Sequence 2:XP_006235068.1 Gene:Ptpra / 25167 RGDID:3450 Length:805 Species:Rattus norvegicus


Alignment Length:167 Identity:35/167 - (20%)
Similarity:60/167 - (35%) Gaps:60/167 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   365 STLEGVTKTMYSRGTHDQHVTSLDDFSYATFE--KGQSSVVA----------------------L 405
            ||..|.| |:...||:...:|. :.|:.|..|  :|.||..|                      :
  Rat    93 STESGGT-TISPNGTYGTWLTD-NQFTDARTEPWEGNSSTAATTPETFPPAGNSDSKDRRDETPI 155

  Fly   406 AVTCVIFGSCLLL--SLIAYFYLRYKTCR-------GRRLTGGNTHEMTLQT------------- 448
            ....|...|.|::  .:|..:.||:|..:       ..||:.|.|.::..|:             
  Rat   156 IAVMVALSSLLVIVFIIIVLYMLRFKKYKQAGSHSNSFRLSNGRTEDVEPQSVPLLARSPSTNRK 220

  Fly   449 ----PI--IERENNGYLVEDDPLPHSPENFKQQLQQL 479
                |:  :|.|.|..:.:|:.|      |:::...|
  Rat   221 FPPLPVDKLEEEINRRMADDNKL------FREEFNAL 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WsckNP_733018.1 WSC 42..115 CDD:280068
fn3 130..222 CDD:278470
TyrKc 493..746 CDD:197581
PTKc 497..750 CDD:270623
PtpraXP_006235068.1 PHA03255 <18..177 CDD:165513 19/85 (22%)
R-PTPc-A-1 217..512 CDD:350469 8/41 (20%)
R-PTPc-A-2 566..793 CDD:350471
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4228
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.