DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wsck and Fgfr2

DIOPT Version :9

Sequence 1:NP_733018.1 Gene:Wsck / 318600 FlyBaseID:FBgn0046685 Length:791 Species:Drosophila melanogaster
Sequence 2:NP_036844.1 Gene:Fgfr2 / 25022 RGDID:2611 Length:841 Species:Rattus norvegicus


Alignment Length:475 Identity:100/475 - (21%)
Similarity:197/475 - (41%) Gaps:101/475 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   381 DQHVTSLDDFSYATFEKGQSSVVALAVTC--VIFGSCLLLSLIAYFYLRYKTCRGRRLTGGN--T 441
            ::.:|:..|:            :.:|:.|  |...:|:::::|   :.|.||...:......  .
  Rat   386 EKEITASPDY------------LEIAIYCIGVFLIACMVVTVI---FCRMKTTTKKPDFSSQPAV 435

  Fly   442 HEMTLQTPI-----IERENNGYLVEDDPLPHSPENFKQ----QLQQLVEGYE-------RIPRNA 490
            |::|.:.|:     :..|::..:..:.||.........    .:...|..||       ..||: 
  Rat   436 HKLTKRIPLRRQVTVSAESSSSMNSNTPLVRITTRLSSTADTPMLAGVSEYELPEDPKWEFPRD- 499

  Fly   491 LRLNVNDVIGDGRFGEIITGKVSTNDFARD---CTLHVLCL-DDLNGTTQAQLLRELRQLSQLKR 551
             :|.:...:|:|.||:::..:....|..|.   .|:.|..| ||......:.|:.|:..:..:.:
  Rat   500 -KLTLGKPLGEGCFGQVVMAEAVGIDKDRPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGK 563

  Fly   552 QEHLLDFYGVSASPDWFYLIFEQQRMSLKRKLVESRL---MAPSPRLTSLSEQL-----VLQWIY 608
            .:::::..|........|:|.|.......|:.:.:|.   |..|..:..:.|:.     ::...|
  Rat   564 HKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPPGMEYSYDINRVPEEQMTFKDLVSCTY 628

  Fly   609 ELASAMNYLSSCQVVHRQLCSHSVFVTSDFKLKLSVFGPLPYMNIARQQPDHN------------ 661
            :||..|.||:|.:.:||.|.:.:|.||.:..:|::.||      :||   |.|            
  Rat   629 QLARGMEYLASQKCIHRDLAARNVLVTENNVMKIADFG------LAR---DINNIDYYKKTTNGR 684

  Fly   662 ---RWLAPEVLRHQHHHSTRSDVWSLACVAWECCALGGTPYANAVASNQQLLEAIRAAVRPAQPA 723
               :|:|||.| ....::.:|||||...:.||...|||:||.....  ::|.:.::...|..:|.
  Rat   685 LPVKWMAPEAL-FDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPV--EELFKLLKEGHRMDKPT 746

  Fly   724 YVYGDLYQLLLNCWQLEPSERSSCEDVAFGVRQLMT-----------------SPRHALSFDRVA 771
            ....:||.::.:||...||:|.:.:.:...:.:::|                 ||.:..:....:
  Rat   747 NCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLTTNEEYLDLTQPLEQYSPSYPDTRSSCS 811

  Fly   772 GGLDTL--------PPYLPQ 783
            .|.|::        .|.|||
  Rat   812 SGDDSVFSPDPMPYDPCLPQ 831

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WsckNP_733018.1 WSC 42..115 CDD:280068
fn3 130..222 CDD:278470
TyrKc 493..746 CDD:197581 70/279 (25%)
PTKc 497..750 CDD:270623 69/279 (25%)
Fgfr2NP_036844.1 Ig 50..143 CDD:416386
Ig strand A 50..53 CDD:409353
Ig strand A' 66..72 CDD:409353
Ig strand B 75..85 CDD:409353
Ig strand C 88..93 CDD:409353
Ig strand C' 96..98 CDD:409353
Ig strand D 103..107 CDD:409353
Ig strand E 110..115 CDD:409353
Ig strand F 121..130 CDD:409353
Ig strand G 133..143 CDD:409353
IgI_2_FGFR 173..267 CDD:409443
Ig strand B 194..198 CDD:409443
Ig strand C 207..211 CDD:409443
Ig strand E 233..237 CDD:409443
Ig strand F 247..252 CDD:409443
Ig strand G 260..263 CDD:409443
Ig 275..377 CDD:416386
Ig strand A 275..278 CDD:409353
Ig strand A' 282..286 CDD:409353
Ig strand B 294..301 CDD:409353
Ig strand C 305..312 CDD:409353
Ig strand D 327..332 CDD:409353
Ig strand E 342..347 CDD:409353
Ig strand F 355..363 CDD:409353
Ig strand G 366..374 CDD:409353
FGFR3_TM 391..421 CDD:407957 7/44 (16%)
PTKc_FGFR2 476..788 CDD:270679 76/325 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.