DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wsck and FLT3

DIOPT Version :9

Sequence 1:NP_733018.1 Gene:Wsck / 318600 FlyBaseID:FBgn0046685 Length:791 Species:Drosophila melanogaster
Sequence 2:NP_004110.2 Gene:FLT3 / 2322 HGNCID:3765 Length:993 Species:Homo sapiens


Alignment Length:421 Identity:90/421 - (21%)
Similarity:153/421 - (36%) Gaps:121/421 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   413 GSCLLLSLIAYFYLRYKTCRGRRLTGGNTHEMTLQ-TPIIERENNGYLVEDDPLPHSPENFKQQL 476
            |.|||..::....:.:|..:..|      :|..|| ..:....:|.|...|         |::  
Human   549 GVCLLFIVVLTLLICHKYKKQFR------YESQLQMVQVTGSSDNEYFYVD---------FRE-- 596

  Fly   477 QQLVEGYE-----RIPRNALRLNVNDVIGDGRFGEIITGK---VSTNDFARDCTLHVLCLDDLNG 533
                  ||     ..||.  .|....|:|.|.||:::...   :|....:....:.:| .:..:.
Human   597 ------YEYDLKWEFPRE--NLEFGKVLGSGAFGKVMNATAYGISKTGVSIQVAVKML-KEKADS 652

  Fly   534 TTQAQLLRELRQLSQLKRQEHLLDFYGVSASPDWFYLIFE------------QQRMSLKRKLVE- 585
            :.:..|:.||:.::||...|::::..|........|||||            .:|....|...| 
Human   653 SEREALMSELKMMTQLGSHENIVNLLGACTLSGPIYLIFEYCCYGDLLNYLRSKREKFHRTWTEI 717

  Fly   586 ----------------------SRLMAPSPRLTSLS------------------------EQL-- 602
                                  ||.:...|....:|                        |.|  
Human   718 FKEHNFSFYPTFQSHPNSSMPGSREVQIHPDSDQISGLHGNSFHSEDEIEYENQKRLEEEEDLNV 782

  Fly   603 -----VLQWIYELASAMNYLSSCQVVHRQLCSHSVFVTSDFKLKLSVFGPLPYMNIARQ-QPDHN 661
                 :|.:.|::|..|.:|.....|||.|.:.:|.||....:|:..||      :||. ..|.|
Human   783 LTFEDLLCFAYQVAKGMEFLEFKSCVHRDLAARNVLVTHGKVVKICDFG------LARDIMSDSN 841

  Fly   662 -----------RWLAPEVLRHQHHHSTRSDVWSLACVAWECCALGGTPYANAVASNQQLLEAIRA 715
                       :|:|||.| .:..::.:|||||...:.||..:||..||. .:..:....:.|:.
Human   842 YVVRGNARLPVKWMAPESL-FEGIYTIKSDVWSYGILLWEIFSLGVNPYP-GIPVDANFYKLIQN 904

  Fly   716 AVRPAQPAYVYGDLYQLLLNCWQLEPSERSS 746
            ..:..||.|...::|.::.:||..:..:|.|
Human   905 GFKMDQPFYATEEIYIIMQSCWAFDSRKRPS 935

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WsckNP_733018.1 WSC 42..115 CDD:280068
fn3 130..222 CDD:278470
TyrKc 493..746 CDD:197581 72/333 (22%)
PTKc 497..750 CDD:270623 72/331 (22%)
FLT3NP_004110.2 ig 256..345 CDD:278476
PKc_like 572..947 CDD:304357 84/392 (21%)
Important for normal regulation of the kinase activity and for maintaining the kinase in an inactive state in the absence of bound ligand 591..597 2/22 (9%)
Pkinase_Tyr 610..943 CDD:285015 73/335 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.