DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wsck and Ptprm

DIOPT Version :9

Sequence 1:NP_733018.1 Gene:Wsck / 318600 FlyBaseID:FBgn0046685 Length:791 Species:Drosophila melanogaster
Sequence 2:NP_001344554.1 Gene:Ptprm / 19274 MGIID:102694 Length:1486 Species:Mus musculus


Alignment Length:573 Identity:113/573 - (19%)
Similarity:176/573 - (30%) Gaps:214/573 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 TYSSLPAF-PQPEFMVQS-------TETQFELTDLHPATLYNISVRAMCKDAQVGQSECGQASIE 240
            ||.::.:| |:.:...||       .||.|....|:|.|.|:.::|     |...:.....|:.:
Mouse   519 TYKAVSSFDPEIDLSNQSGRVSKLGNETHFLFFGLYPGTTYSFTIR-----ASTAKGFGPPATNQ 578

  Fly   241 ATTEVGLPSPVPA----QPKILSRTDRTVTIELSPIRNDNGPLSKLLVIVE-----------YVD 290
            .||::..|| :||    .|  |::||.|||:.|.|.::...|:|...::||           .:.
Mouse   579 FTTKISAPS-MPAYEFETP--LNQTDNTVTVMLKPAQSRGAPVSVYQIVVEEERPRRTKKTTEIL 640

  Fly   291 NALSQPF---DAQLLGSWQQAQQDGVPYYIAAELDYDRPEDN--RTRRFVVGDGKRYGRFTNKPL 350
            .....|.   :|.:|.|         .||.|||.    |.|:  ..:.|.:||.|.|..:.|.||
Mouse   641 KCYPVPIHFQNASILNS---------QYYFAAEF----PADSLQAAQPFTIGDNKTYNGYWNTPL 692

  Fly   351 DQPDAHVHISLGLVSTLEGVTKTMYSRGTHDQHVTSLDDFSYATFEKGQSSVVALAVTCVIFGSC 415
             .|.....|.....|...|.||                                  :.||     
Mouse   693 -LPHKSYRIYYQAASRANGETK----------------------------------IDCV----- 717

  Fly   416 LLLSLIAYFYLRYKTCRGRRLTGGNTHEMTLQTPIIERENNGYLVEDDPLPHSPENFKQQLQQLV 480
                                       .:..:..||                        :.||.
Mouse   718 ---------------------------RVATKAAII------------------------VTQLT 731

  Fly   481 EGYERIPRNALRLNVNDVIGDGRFGEIITGKVSTNDFARDCTLHVLCLDDLNGTTQAQLLRELRQ 545
            ..|.||...|         |||:    :||.|:.....                           
Mouse   732 TPYIRIAPAA---------GDGQ----LTGAVTPKPVP--------------------------- 756

  Fly   546 LSQLKRQEHLLDFYGVSASPDWFYLIF-------EQQRMSLKRKLVESRLMAPSPRLTSLSEQLV 603
             ...|:.:|.:...||.|....|.:||       ::::::.|||...|........:.:..::..
Mouse   757 -EPEKQTDHTVKIAGVIAGILLFVIIFLGVVLVMKKRKLAKKRKETMSSTRQEMTVMVNSMDKSY 820

  Fly   604 LQWIYELASAMNYLSSCQVVHRQLCSHSVFVTSDFKLKLSV---FGPLPYMNIARQQPDHNRWLA 665
            .:.......|.:::.:..:..|.:.|.|.|......|..||   :.|.|::..|.....|.....
Mouse   821 AEQGTNCDEAFSFMGTHNLNGRSVSSPSSFTMKTNTLSTSVPNSYYPDPFVPTAILDETHTMASD 885

  Fly   666 PEVLRHQHHHSTR--SDVWSLACVAWECCALGGTPYANAVASNQQLLEAIRAA 716
            ...|...|.:..|  :||                ||...     ||..|||.|
Mouse   886 TSSLAQPHTYKKREAADV----------------PYQTG-----QLHPAIRVA 917

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WsckNP_733018.1 WSC 42..115 CDD:280068
fn3 130..222 CDD:278470 13/45 (29%)
TyrKc 493..746 CDD:197581 43/236 (18%)
PTKc 497..750 CDD:270623 43/232 (19%)
PtprmNP_001344554.1 MAM 22..182 CDD:214533
ig 192..274 CDD:278476
FN3 282..361 CDD:214495
FN3 383..467 CDD:214495
fn3 499..574 CDD:306538 15/59 (25%)
PTPc 933..1187 CDD:214550
PTPc 1249..1481 CDD:238006
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 58 1.000 Domainoid score I10721
eggNOG 1 0.900 - - E2759_KOG4228
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.