DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wsck and zig-13

DIOPT Version :9

Sequence 1:NP_733018.1 Gene:Wsck / 318600 FlyBaseID:FBgn0046685 Length:791 Species:Drosophila melanogaster
Sequence 2:NP_497161.1 Gene:zig-13 / 188571 WormBaseID:WBGene00020546 Length:352 Species:Caenorhabditis elegans


Alignment Length:339 Identity:68/339 - (20%)
Similarity:104/339 - (30%) Gaps:148/339 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   416 LLLSLIAYFYLRYKTCRGRRLTGGNTHEMTLQTPIIERENNGYLVEDDPLPHSPENFKQQLQQLV 480
            ||.:|:..|:|::.|              |.|||     |....|       .|.:|....|...
 Worm     4 LLNALVISFFLKFVT--------------TDQTP-----NTQIFV-------GPPSFSIFEQDFY 42

  Fly   481 EGYERI----------PRNA------------LRLNVNDVIG-DGRFGEIITGKVS-TNDFARDC 521
            ....|:          |..|            :|:|....|. ||.|...:...|| |.|     
 Worm    43 YPGTRLHIECLSISIPPETAFLEYRTKKTGSFVRINYQRAISDDGTFDSGVFYNVSLTED----- 102

  Fly   522 TLHVLCLDDLNGTTQAQLLRELRQLSQLKRQEHLLD-----FYGVSASPDWFYLIFEQQRMSLKR 581
             :..||      .|:.|.....:.:       |:.|     ||.|..:|.:...::||..::   
 Worm   103 -IEFLC------WTRGQGHPSFKHI-------HVADGPSKAFYNVGGAPRFQKSVYEQDTVN--- 150

  Fly   582 KLVESRLMAPSPRLTSLSEQLVLQWIYELASAMNYLSSCQVVHRQLCSHSVFVTSDFKLKLSVFG 646
                  |....|.                 ||:|:..|.::.:    |:|   |||..:...:.|
 Worm   151 ------LFCAIPH-----------------SAINWKVSWRLEN----SNS---TSDLSVTTLIDG 185

  Fly   647 PLPY-----MNIARQQPDHNRWLAPEVLRHQHHHSTRSDVWSLACVAWECCALGGTPYANAVASN 706
            ...|     .||                       |:|.|::  ||.          .|:.....
 Worm   186 NSKYHVTTVKNI-----------------------TKSGVYT--CVI----------EADKFKER 215

  Fly   707 QQLLEAIRAAVRPA 720
            :||||.: ..|:||
 Worm   216 RQLLETV-IKVKPA 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WsckNP_733018.1 WSC 42..115 CDD:280068
fn3 130..222 CDD:278470
TyrKc 493..746 CDD:197581 49/240 (20%)
PTKc 497..750 CDD:270623 48/236 (20%)
zig-13NP_497161.1 IG_like 251..301 CDD:214653
Ig 251..289 CDD:299845
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.