DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wsck and W03A5.1

DIOPT Version :9

Sequence 1:NP_733018.1 Gene:Wsck / 318600 FlyBaseID:FBgn0046685 Length:791 Species:Drosophila melanogaster
Sequence 2:NP_498153.3 Gene:W03A5.1 / 175744 WormBaseID:WBGene00020966 Length:803 Species:Caenorhabditis elegans


Alignment Length:330 Identity:70/330 - (21%)
Similarity:129/330 - (39%) Gaps:78/330 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   471 NFKQQLQQLVEGY----------ERIPRNALRLNVN--------------DVIGDGRFGEIITGK 511
            |..::.::||..|          |.:|.:...:.:|              |.||.|.||.:..||
 Worm   448 NLSKEEKELVSSYMKNQGPQKKWENMPLHETSIRINSLFYVDGKKIDCGTDQIGKGAFGTVKKGK 512

  Fly   512 VSTNDFARDCTLHV--LCLDDLNGTTQAQLLRELRQLSQLKRQEHLLDFYGVSASPD--WFYLIF 572
            . .|.......:.|  |.|.:.:...:.....|: ::.::....:::.:||.|.|.|  ..||:|
 Worm   513 F-RNSLGESVPVAVKKLGLRESSKDERNPAFSEM-EILEMVAHPNIVFYYGFSISGDEQALYLLF 575

  Fly   573 EQQRMSLKRKLVESRLMAPSPRLTSLSEQLVLQWIYELASAMNYL--SSCQVVHRQLCS------ 629
            |....||.:.:.:|..:        |||...|..:.::...|::|  .:..:||..|.:      
 Worm   576 ELMDTSLDKFIDKSDAI--------LSENERLDILAQICRGMSFLHTRTPSIVHGDLAARNVLLK 632

  Fly   630 -HSVFVTSDFKLKLSVFG-----------------PLPYMNIARQQPDHNRWLAPEVLRHQHHHS 676
             |.|:: ..:..|::..|                 .:|:           :||.|||| .....|
 Worm   633 KHPVYI-KKYICKITDLGLAKTCLDELYTSYDDPTKIPF-----------KWLPPEVL-GSRTLS 684

  Fly   677 TRSDVWSLACVAWECCALGGTPYANAVASNQQLLEAIRAAVRPAQPAYVYGDLYQLLLNCWQLEP 741
            .::|:|:...|.:|.|...|.||...|.:: .|.:.:.......:..::...:|.:.|:|.:..|
 Worm   685 LKTDIWAFGIVCFEVCDKVGEPYGACVPTS-NLCQYLTDGYVHEKGLHMSDTIYNIALDCMRQHP 748

  Fly   742 SERSS 746
            .||.|
 Worm   749 IERPS 753

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WsckNP_733018.1 WSC 42..115 CDD:280068
fn3 130..222 CDD:278470
TyrKc 493..746 CDD:197581 63/296 (21%)
PTKc 497..750 CDD:270623 63/280 (23%)
W03A5.1NP_498153.3 PTKc 498..761 CDD:270623 63/280 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.