DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wsck and Kdr

DIOPT Version :9

Sequence 1:NP_733018.1 Gene:Wsck / 318600 FlyBaseID:FBgn0046685 Length:791 Species:Drosophila melanogaster
Sequence 2:NP_034742.2 Gene:Kdr / 16542 MGIID:96683 Length:1345 Species:Mus musculus


Alignment Length:440 Identity:101/440 - (22%)
Similarity:175/440 - (39%) Gaps:127/440 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   396 EKGQSSVVALAVTCVIFGSCLLLSLIAYFYLRYKTCRGRRLTGGNTHEMTLQTPIIERENNGYL- 459
            ||....|:.|..|.||   .:...|:....||         |....:|..|:|        ||| 
Mouse   757 EKTNLEVIILVGTAVI---AMFFWLLLVIVLR---------TVKRANEGELKT--------GYLS 801

  Fly   460 --VEDDPLPHSPENFKQQLQQLVEGYERIPRNAL-------RLNVNDVIGDGRFGEIITGKVSTN 515
              ::.|.||            |.|..||:|.:|.       ||.:...:|.|.||::|.......
Mouse   802 IVMDPDELP------------LDERCERLPYDASKWEFPRDRLKLGKPLGRGAFGQVIEADAFGI 854

  Fly   516 DFARDC-TLHVLCLDDLNGTTQAQ---LLRELRQLSQLKRQEHLLDFYGVSASPDWFYLI----- 571
            |....| |:.|..|.:  |.|.::   |:.||:.|..:....::::..|....|....::     
Mouse   855 DKTATCKTVAVKMLKE--GATHSEHRALMSELKILIHIGHHLNVVNLLGACTKPGGPLMVIVEFC 917

  Fly   572 -------------------------FEQQR-------MSLKRKL---VESRLMAPS-----PRLT 596
                                     |.|.:       :.|||:|   ..|:..|.|     ..|:
Mouse   918 KFGNLSTYLRGKRNEFVPYKSKGARFRQGKDYVGELSVDLKRRLDSITSSQSSASSGFVEEKSLS 982

  Fly   597 SLSEQ----------LVLQ----WIYELASAMNYLSSCQVVHRQLCSHSVFVTSDFKLKLSVFGP 647
            .:.|:          |.|:    :.:::|..|.:|:|.:.:||.|.:.::.::....:|:..|| 
Mouse   983 DVEEEEASEELYKDFLTLEHLICYSFQVAKGMEFLASRKCIHRDLAARNILLSEKNVVKICDFG- 1046

  Fly   648 LPYMNIAR---QQPDHNR---------WLAPEVLRHQHHHSTRSDVWSLACVAWECCALGGTPYA 700
                 :||   :.||:.|         |:|||.: ....::.:|||||...:.||..:||.:||.
Mouse  1047 -----LARDIYKDPDYVRKGDARLPLKWMAPETI-FDRVYTIQSDVWSFGVLLWEIFSLGASPYP 1105

  Fly   701 NAVASNQQLLEAIRAAVRPAQPAYVYGDLYQLLLNCWQLEPSERSSCEDV 750
             .|..:::....::...|...|.|...::||.:|:||..:|::|.|..::
Mouse  1106 -GVKIDEEFCRRLKEGTRMRAPDYTTPEMYQTMLDCWHEDPNQRPSFSEL 1154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WsckNP_733018.1 WSC 42..115 CDD:280068
fn3 130..222 CDD:278470
TyrKc 493..746 CDD:197581 73/327 (22%)
PTKc 497..750 CDD:270623 73/327 (22%)
KdrNP_034742.2 Ig_3 31..105 CDD:404760
Ig 226..327 CDD:416386
Ig strand A 226..230 CDD:409353
Ig strand A' 236..240 CDD:409353
Ig strand B 242..251 CDD:409353
Ig strand C 258..263 CDD:409353
Ig strand C' 266..268 CDD:409353
Ig strand D 272..280 CDD:409353
Ig strand E 288..296 CDD:409353
Ig strand F 306..312 CDD:409353
Ig strand G 317..323 CDD:409353
Ig 331..419 CDD:416386
Ig strand A 331..334 CDD:409353
Ig strand A' 341..345 CDD:409353
Ig strand B 347..358 CDD:409353
Ig strand C 362..368 CDD:409353
Ig strand C' 370..373 CDD:409353
Ig strand D 378..381 CDD:409353
Ig strand E 383..388 CDD:409353
Ig strand F 396..404 CDD:409353
Ig strand G 410..419 CDD:409353
Ig_3 549..643 CDD:404760
I-set 665..742 CDD:400151
Ig strand B 682..686 CDD:409353
Ig strand C 695..699 CDD:409353
Ig strand E 718..722 CDD:409353
Ig strand F 732..737 CDD:409353
VEGFR-2_TMD 757..791 CDD:375470 11/45 (24%)
PTKc_VEGFR2 824..1165 CDD:270681 75/341 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1272..1316
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.