DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wsck and CSF1R

DIOPT Version :9

Sequence 1:NP_733018.1 Gene:Wsck / 318600 FlyBaseID:FBgn0046685 Length:791 Species:Drosophila melanogaster
Sequence 2:NP_001275634.1 Gene:CSF1R / 1436 HGNCID:2433 Length:972 Species:Homo sapiens


Alignment Length:778 Identity:156/778 - (20%)
Similarity:263/778 - (33%) Gaps:280/778 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 QYCGGVGVHSYYSTILTKQPGPHHLRISNKTENSLTLSWNAYEARKLLLAGGAEAVLPNQLLDNF 175
            |:.|.      ||.:.:...|.|          |.::.:...|:..|.|:.....:....:.:..
Human   271 QHAGN------YSCVASNVQGKH----------STSMFF
RVVESAYLNLSSEQNLIQEVTVGEGL 319

  Fly   176 LIKAQVLKTYSSLPAF------------PQPEFMVQSTETQFELTDLHPATLYNISVRAMCKDAQ 228
            .:|..| :.|..|..|            |:|:....:|:..:..|       :.:|:      .:
Human   320 NLKVMV-EAYPGLQGFNWTYLGPFSDHQPEPKLANATTKDTYRHT-------FTLSL------PR 370

  Fly   229 VGQSECGQASIEATTEVGLPSPVPAQPKILSRTDRTVTIELSPIR------------NDNGPLSK 281
            :..||.|:.|..|....|.               |.:|.||: :|            |.:|.|  
Human   371 LKPSEAGRYSFLARNPGGW---------------RALTFELT-LRYPPEVSVIWTFINGSGTL-- 417

  Fly   282 LLVIVEYVDNALSQP--------------FDAQLLGSWQQAQQDGVPYYIAAE----------LD 322
            |.....|     .||              .:||:|..|    .|..|..::.|          |.
Human   418 LCAASGY-----PQPNVTWLQCSGHTDRCDEAQVLQVW----DDPYPEVLSQEPFHKVTVQSLLT 473

  Fly   323 YDRPEDNRT----RRFVVGDGKRYGRFTNKPLDQPDAHVHISLGLVSTLEGVTKTMYSRGTHDQH 383
            .:..|.|:|    ....||.|..             |.:.||.|                   .|
Human   474 VETLEHNQTYECRAHNSVGSGSW-------------AFIPISAG-------------------AH 506

  Fly   384 VTSLDDFSYATFEKGQSSVVALAVTCVIFGSCLLLSLIAYFYLRYKTCRGRRLTGGNTHEMTLQT 448
            ....|:|.:          ..:.|.|:...:.|||.|:...| :||          ...:..::.
Human   507 THPPDEFLF----------TPVVVACMSIMALLLLLLLLLLY-KYK----------QKPKYQVRW 550

  Fly   449 PIIER-ENNGY-LVEDDPLPHSPENFKQQLQQLVEGYERIPRNALRLNVNDVIGDGRFGEII--- 508
            .|||. |.|.| .::...||::            |.:| .|||  .|.....:|.|.||:::   
Human   551 KIIESYEGNSYTFIDPTQLPYN------------EKWE-FPRN--NLQFGKTLGAGAFGKVVEAT 600

  Fly   509 ---TGKVSTNDFARDCTLHVLCLDDLNGTTQAQ----LLRELRQLSQLKRQEHLLDFYGVSASPD 566
               .||       .|..|.| .:..|..|..|.    |:.||:.:|.|.:.|::::..|......
Human   601 AFGLGK-------EDAVLKV-AVKMLKSTAHADEKEALMSELKIMSHLGQHENIVNLLGACTHGG 657

  Fly   567 WFYLIFE----------------------------------QQRMSLKRK--------------- 582
            ...:|.|                                  .:.:.|::|               
Human   658 PVLVITEYCCYGDLLNFLRRKAEAMLGPSLSPGQDPEGGVDYKNIHLEKKYVRRDSGFSSQGVDT 722

  Fly   583 LVESRLMAPSPRLTSLSEQ-------------LVLQWIYELASAMNYLSSCQVVHRQLCSHSVFV 634
            .||.|.::.|.. .|.|||             .:|.:..::|..|.:|:|...:||.:.:.:|.:
Human   723 YVEMRPVSTSSN-DSFSEQDLDKEDGRPLELRDLLHFSSQVAQGMAFLASKNCIHRDVAARNVLL 786

  Fly   635 TSDFKLKLSVFGPLPYMNIARQ-QPDHN-----------RWLAPEVLRHQHHHSTRSDVWSLACV 687
            |:....|:..||      :||. ..|.|           :|:|||.: ....::.:|||||...:
Human   787 TNGHVAKIGDFG------LARDIMNDSNYIVKGNARLPVKWMAPESI-FDCVYTVQSDVWSYGIL 844

  Fly   688 AWECCALGGTPYANAVASNQQLLEAIRAAVRPAQPAYVYGDLYQLLLNCWQLEPSERSSCEDV 750
            .||..:||..||. .:..|.:..:.::...:.||||:...::|.::..||.|||:.|.:.:.:
Human   845 LWEIFSLGLNPYP-GILVNSKFYKLVKDGYQMAQPAFAPKNIYSIMQACWALEPTHRPTFQQI 906

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WsckNP_733018.1 WSC 42..115 CDD:280068 1/3 (33%)
fn3 130..222 CDD:278470 16/103 (16%)
TyrKc 493..746 CDD:197581 75/336 (22%)
PTKc 497..750 CDD:270623 74/336 (22%)
CSF1RNP_001275634.1 IG_like 28..85 CDD:214653
ig 207..293 CDD:365836 7/37 (19%)
Ig4_SCFR_like 299..400 CDD:319281 22/130 (17%)
Ig 416..495 CDD:319273 18/89 (20%)
Regulatory juxtamembrane domain 542..574 8/43 (19%)
PTKc_CSF-1R 543..914 CDD:133237 88/396 (22%)
Activation loop 796..818 6/27 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 918..950
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.