DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wsck and Flt1

DIOPT Version :9

Sequence 1:NP_733018.1 Gene:Wsck / 318600 FlyBaseID:FBgn0046685 Length:791 Species:Drosophila melanogaster
Sequence 2:NP_034358.2 Gene:Flt1 / 14254 MGIID:95558 Length:1333 Species:Mus musculus


Alignment Length:517 Identity:112/517 - (21%)
Similarity:198/517 - (38%) Gaps:168/517 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   382 QHVTSLDDFSY---ATFEKG---------------QSSVVALAVTCVIFGSCLLLSLIAYFYLRY 428
            :.||..|:..|   ||.:||               :|::..:.:||....:.|...|:..|.   
Mouse   720 ERVTEEDEGVYRCRATNQKGAVESAAYLTVQGTSDKSNLELITLTCTCVAATLFWLLLTLFI--- 781

  Fly   429 KTCRGRRLTGGNTHEMTLQTPIIERENNGYLVEDDPLPHSPENFKQQLQQLVEGYERIPRNAL-- 491
                 |:|...::...|....||        ::.|.:|            |.|..||:|.:|.  
Mouse   782 -----RKLKRSSSEVKTDYLSII--------MDPDEVP------------LDEQCERLPYDASKW 821

  Fly   492 -----RLNVNDVIGDGRFGEIITGKVSTNDFARDCTLHVLCLDDL-NGTTQAQ---LLRELRQLS 547
                 ||.:...:|.|.||:::  :.|.....:..|...:.:..| .|.|.::   |:.||:.|:
Mouse   822 EFARERLKLGKSLGRGAFGKVV--QASAFGIKKSPTCRTVAVKMLKEGATASEYKALMTELKILT 884

  Fly   548 QLKRQEHLLDFYG------------------------VSASPDWFYLIFEQQ-RMSLKRKLVESR 587
            .:....::::..|                        :.:..|.|.|..:.. .|.||::.:|..
Mouse   885 HIGHHLNVVNLLGACTKQGGPLMVIVEYCKYGNLSNYLKSKRDLFCLNKDAALHMELKKESLEPG 949

  Fly   588 L-MAPSPRLTSLSEQLV---------------------------------LQWIYELASAMNYLS 618
            | ....|||.|:|...|                                 :.:.:::|..|.:||
Mouse   950 LEQGQKPRLDSVSSSSVTSSSFPEDRSVSDVEGDEDYSEISKQPLTMEDLISYSFQVARGMEFLS 1014

  Fly   619 SCQVVHRQLCSHSVFVTSDFKLKLSVFGPLPYMNIAR---QQPDHNR---------WLAPEVLRH 671
            |.:.:||.|.:.::.::.:..:|:..||      :||   :.||:.|         |:|||.: .
Mouse  1015 SRKCIHRDLAARNILLSENNVVKICDFG------LARDIYKNPDYVRRGDTRLPLKWMAPESI-F 1072

  Fly   672 QHHHSTRSDVWSLACVAWECCALGGTPYANAVASNQQLLEAIRAAVRPAQPAYVYGDLYQLLLNC 736
            ...:||:|||||...:.||..:|||:||. .|..::.....::..:|...|.|...::||::|:|
Mouse  1073 DKVYSTKSDVWSYGVLLWEIFSLGGSPYP-GVQMDEDFCSRLKEGMRMRTPEYATPEIYQIMLDC 1136

  Fly   737 WQLEPSERSSCEDVAFGVRQLMTSPRHALSFDRVA---------GGLDTLPPYLPQLEAVAT 789
            |..:|.||                ||.|...:::.         .|.|.:|     |.|:.|
Mouse  1137 WHKDPKER----------------PRFAELVEKLGDLLQANVQQDGKDYIP-----LNAILT 1177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WsckNP_733018.1 WSC 42..115 CDD:280068
fn3 130..222 CDD:278470
TyrKc 493..746 CDD:197581 75/327 (23%)
PTKc 497..750 CDD:270623 74/327 (23%)
Flt1NP_034358.2 IG_like 40..129 CDD:214653
Ig 46..127 CDD:299845
IG_like 144..220 CDD:214653
IG_like 238..329 CDD:214653
Ig 246..328 CDD:299845
Ig 354..425 CDD:299845
IG_like 440..553 CDD:214653
Ig 452..550 CDD:143165
IG 570..641 CDD:214652
IGc2 570..641 CDD:197706
I-set 662..749 CDD:254352 8/28 (29%)
IGc2 677..739 CDD:197706 6/18 (33%)
PKc_like 820..1157 CDD:304357 79/362 (22%)
Pkinase_Tyr 828..1154 CDD:285015 78/351 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 947..983 8/35 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.