DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wsck and Flt4

DIOPT Version :9

Sequence 1:NP_733018.1 Gene:Wsck / 318600 FlyBaseID:FBgn0046685 Length:791 Species:Drosophila melanogaster
Sequence 2:NP_446104.2 Gene:Flt4 / 114110 RGDID:621737 Length:1363 Species:Rattus norvegicus


Alignment Length:780 Identity:158/780 - (20%)
Similarity:270/780 - (34%) Gaps:249/780 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 VLASEKCFCANVLEPQEQQDEQLCNTRCLANKAQYCGGVGVHSYYSTILTKQPGPHHLRI-SNKT 141
            |.|..||...|    :..|||:|                 ::.|.:||      |....| |..:
  Rat   528 VSAMYKCVVFN----KVGQDERL-----------------IYFYVTTI------PDGFSIESEPS 565

  Fly   142 ENSLTLSWNAYEARKLLLAGGAEAVLPNQLLDNFLIKAQVLKTYSSLPAFPQPEFMVQSTETQFE 206
            |:.|       |.:.:.|:..|         ||:        ||..|..:            :..
  Rat   566 EDPL-------EGQSVRLSCRA---------DNY--------TYEHLRWY------------RLN 594

  Fly   207 LTDLHPA-------TLYNISVRAMCKDAQVGQSECGQASIEATTEVGLPSPVPAQPKILSRTDRT 264
            |:.||.|       ...|:.:.|...:|.:.::|.|  :..||..:.:|...|       ..:..
  Rat   595 LSTLHDAQGNPLLLDCKNVHLFATPLEANLEEAEPG--ARHATLSLNIPRVAP-------EDEGD 650

  Fly   265 VTIELSPIRNDNGPLSKLLVIVEYVDNALSQPFDAQLL--------GSWQQ------AQQDGVPY 315
            ...|:...||.:....|..:.|:    ||..|...|.|        .|.:.      |....:.:
  Rat   651 YVCEVQDRRNQDKHCHKKYLSVQ----ALEAPRLTQNLTDLLVNVSDSLEMRCPVAGAHVPSIVW 711

  Fly   316 Y-----IAAELDYDRPEDNR---TRRFVVGDGKRYGRFTNKPLDQPDAHVHISLGLVSTLEGVTK 372
            |     :..|...|..:.|:   .:|....|..||                  |..|...:|...
  Rat   712 YKDERLLEKESGIDLADSNQRLSIQRVREEDAGRY------------------LCSVCNAKGCVN 758

  Fly   373 TMYS---RGTHDQHVTSLDDFSYATFEKGQSSVVALAVTCVIFGSCLLLSLIAYFYLRYKTCRGR 434
            :..|   .|:.|               ||...:|.|..|.||.....:|.|:.:       |..:
  Rat   759 SSASVAVEGSED---------------KGSMEIVILIGTGVIAVFFWVLLLLIF-------CNMK 801

  Fly   435 RLTGGNTHEMTLQTPIIERENNGYL-VEDDPLPHSPENFKQQLQQLVEGYERIPRNALRLNVNDV 498
            |             |.......||| :..||.....|...:.|...|..:| .||.  ||::..|
  Rat   802 R-------------PAHADIKTGYLSIIMDPGEVPLEEQCEYLSYDVSQWE-FPRE--RLHLGRV 850

  Fly   499 IGDGRFGEIITGKVSTNDFARDC-TLHVLCLDDLNGTTQAQ---LLRELRQLSQLKRQEHLLDFY 559
            :|.|.||:::.......:....| |:.|..|.:  |.|.::   |:.||:.|..:....::::..
  Rat   851 LGHGAFGKVVEASAFGINKGSSCDTVAVKMLKE--GATASEHRALMSELKILIHIGNHLNVVNLL 913

  Fly   560 GVSASPDWFYLIF----------------------------EQQRM----------------SLK 580
            |....|:...::.                            ||:|.                |..
  Rat   914 GACTKPNGPLMVIVEFCKYGNLSNFLRVKRETFDPYAEKSPEQRRRFRAMVEGAKADRRRLGSTD 978

  Fly   581 RKLVESRLM-------APSPR------LTSLSEQLVLQWIYELASAMNYLSSCQVVHRQLCSHSV 632
            |.|....||       ||..:      |:.|:.:.::.:.:::|..|.:|:|.:.:||.|.:.::
  Rat   979 RALFTRFLMGKGSARRAPFVQEAEDLWLSPLTMEDLVCYSFQVALGMEFLASRKCIHRDLAARNI 1043

  Fly   633 FVTSDFKLKLSVFGPLPYMNIAR---QQPDHNR---------WLAPEVLRHQHHHSTRSDVWSLA 685
            .::....:|:..||      :||   :.||:.|         |:|||.: ....::|:|||||..
  Rat  1044 LLSESDIVKICDFG------LARDIYKDPDYVRKGSARLPLKWMAPESI-FDKVYTTQSDVWSFG 1101

  Fly   686 CVAWECCALGGTPYANAVASNQQLLEAIRAAVRPAQPAYVYGDLYQLLLNCWQLEPSERSSCEDV 750
            .:.||..:||.:||. .|..|::..:.::...|...|......:..::.:||..:|..|.:..|:
  Rat  1102 VLLWEIFSLGASPYP-GVQINEEFCQRLKDGTRMRAPELATPAIRHIMQSCWSGDPKARPAFSDL 1165

  Fly   751  750
              Rat  1166  1165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WsckNP_733018.1 WSC 42..115 CDD:280068 9/36 (25%)
fn3 130..222 CDD:278470 18/99 (18%)
TyrKc 493..746 CDD:197581 69/325 (21%)
PTKc 497..750 CDD:270623 68/325 (21%)
Flt4NP_446104.2 Ig_2 137..220 CDD:404734
IgI_VEGFR 230..329 CDD:409448
Ig strand B 248..252 CDD:409448
Ig strand C 263..267 CDD:409448
Ig strand E 293..297 CDD:409448
Ig strand F 307..312 CDD:409448
Ig strand G 320..323 CDD:409448
Ig 331..418 CDD:416386
Ig strand A 332..337 CDD:409353
Ig strand A' 342..347 CDD:409353
Ig strand B 349..360 CDD:409353
Ig strand C 364..370 CDD:409353
Ig strand C' 372..375 CDD:409353
Ig strand D 378..380 CDD:409353
Ig strand E 382..387 CDD:409353
Ig strand F 395..403 CDD:409353
Ig strand G 409..418 CDD:409353
IG_like 570..663 CDD:214653 24/130 (18%)
Ig strand B 574..578 CDD:409353 1/3 (33%)
Ig strand C 587..591 CDD:409353 1/3 (33%)
Ig strand E 636..640 CDD:409353 0/3 (0%)
Ig strand F 650..655 CDD:409353 0/4 (0%)
IGc2 693..755 CDD:197706 12/79 (15%)
Ig strand B 695..699 CDD:409353 0/3 (0%)
Ig strand C 708..712 CDD:409353 0/3 (0%)
Ig strand E 731..735 CDD:409353 0/3 (0%)
Ig strand F 745..750 CDD:409353 3/22 (14%)
VEGFR-2_TMD 770..804 CDD:375470 12/68 (18%)
PKc_like 837..1175 CDD:419665 74/342 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1289..1330
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.