DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wsck and styk1a

DIOPT Version :9

Sequence 1:NP_733018.1 Gene:Wsck / 318600 FlyBaseID:FBgn0046685 Length:791 Species:Drosophila melanogaster
Sequence 2:XP_005159545.1 Gene:styk1a / 101886109 ZFINID:ZDB-GENE-060503-428 Length:435 Species:Danio rerio


Alignment Length:413 Identity:97/413 - (23%)
Similarity:159/413 - (38%) Gaps:84/413 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   403 VALAVTCVIFGSCLLLSLIAYFYLR------YKTCRGRRLTGGNTHEMTLQTPIIERENNGYL-- 459
            |.|.|..|:|....|..:|....|:      |:....|:......|....|..  .|.|..:|  
Zfish    24 VELIVVPVLFLLLFLAIMIILLVLKCSHKKSYRHKHHRKENDHTQHHHNTQGS--HRSNRRHLQG 86

  Fly   460 ----VEDDPL-----------PHSPENFKQQLQQLVEGYERIPRNALRLNVNDVIGDGRFGEIIT 509
                .|.:|:           ||..::....:.|  :..||.|.:...|:...          |:
Zfish    87 IDAPAELNPMEHEVIPMTAQAPHEVQSSASAIPQ--QTTERHPSSFQLLSPLP----------IS 139

  Fly   510 GKVSTNDFARDCTLHVLCLDDLNGTTQAQLLRELRQ----------------LSQLKRQEHLLDF 558
            ..|..::|    |||...:|     .|..:||.|::                ||:|...|.|...
Zfish   140 FSVKQDNF----TLHRAAID-----RQPVILRVLKESANARERQSFLGFSHFLSELGPHESLPKL 195

  Fly   559 YG-VSASPDWFYLIFEQQRMSLKRKLVESR-----LMAPSPRLTSLSEQLVLQWIYELASAMNYL 617
            .| |||.......:.|.:...|...|...|     ..||    ..::|:.:.....::|||:.||
Zfish   196 LGVVSARTPLMMAVEELEHRDLLGFLWRCRQDHTGQAAP----CDMTERRIFTMGAQIASALEYL 256

  Fly   618 SSCQVVHRQLCSHSVFVTSDFKLKLSVFGPLPY--MNIAR----QQPDHNRWLAPEVLRHQHHHS 676
            .|...:|..:.:.||.|..|..:||...||..:  .|.:.    ::.:..:|.|||:|..|....
Zfish   257 HSKNCIHGNVKARSVLVGQDLSVKLWGLGPAYHRKSNASSIEDLEEIETRKWQAPELLARQPLQQ 321

  Fly   677 TRSDVWSLACVAWECCALGGTPYANAVASNQQLLEAIRAAVRPAQPAYVYGDLYQLLLNCWQLEP 741
            : |||||...:.:|...||..|:.|.:||  :||:.::......:|......||.::.:|.:...
Zfish   322 S-SDVWSFGILLYEMVTLGEAPFPNIMAS--ELLQHLQRENTLKRPPNCSNTLYSIMKSCCKWRA 383

  Fly   742 SERSSCEDVAFGVRQLMTSPRHA 764
            .:|.|..::   :|:|.:..|.|
Zfish   384 KDRVSLAEL---IRKLQSGERSA 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WsckNP_733018.1 WSC 42..115 CDD:280068
fn3 130..222 CDD:278470
TyrKc 493..746 CDD:197581 69/280 (25%)
PTKc 497..750 CDD:270623 69/280 (25%)
styk1aXP_005159545.1 PKc_like 158..397 CDD:304357 62/248 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.