DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp8a and Obp99b

DIOPT Version :9

Sequence 1:NP_727322.1 Gene:Obp8a / 31860 FlyBaseID:FBgn0030103 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_001263078.1 Gene:Obp99b / 43497 FlyBaseID:FBgn0039685 Length:149 Species:Drosophila melanogaster


Alignment Length:104 Identity:26/104 - (25%)
Similarity:42/104 - (40%) Gaps:11/104 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 LLRARDQCGRELTAAQRL--QLDRMQFEDAAHVRHYLHCFWSRLQLWLDETGFQAQRI-VQSFG- 100
            |...|.||..::.|::.|  :..:.|:.|.|....||.|.:.:...:..|.||...:| :|..| 
  Fly    33 LTNYRTQCVEKVHASEELVEKYKKWQYPDDAVTHCYLECIFQKFGFYDTEHGFDVHKIHIQLAGP 97

  Fly   101 GERRLNVEQALPAINGCNAKTSSRGSGAQTVVDWCFRAF 139
            |......::....|..|....|..|       |.|.:|:
  Fly    98 GVEVHESDEVHQKIAHCAETHSKEG-------DSCSKAY 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp8aNP_727322.1 PhBP 43..144 CDD:214783 25/101 (25%)
Obp99bNP_001263078.1 PBP_GOBP 24..137 CDD:396118 26/104 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450218
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.