DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp8a and Obp99c

DIOPT Version :9

Sequence 1:NP_727322.1 Gene:Obp8a / 31860 FlyBaseID:FBgn0030103 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_651711.1 Gene:Obp99c / 43494 FlyBaseID:FBgn0039682 Length:151 Species:Drosophila melanogaster


Alignment Length:142 Identity:41/142 - (28%)
Similarity:69/142 - (48%) Gaps:15/142 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLLLLVVELTPPAIPVPMRSSPQSLALLR-ARDQCGRE--LTAAQRLQLDRMQFEDAAHVRHYLH 75
            :|..|:|.|...|:......:|::...:| .|..|.:|  |:..|..||..:.|.:...||.||.
  Fly     1 MLKYLIVALALCAVAHADDWTPKTGEEIRKIRVDCLKENPLSNDQISQLKNLIFPNEPDVRQYLT 65

  Fly    76 CFWSRLQLWLDETGFQAQRIVQSFGGERRLNVEQALPAINGC---NAKTSSRGSGAQTVVDWCFR 137
            |...:|.::.|:.|:.|.|:.:.|  :..|:.|:||.....|   ||:.:      .|.| |.||
  Fly    66 CSAIKLGIFCDQQGYHADRLAKQF--KMDLSEEEALQIAQSCVDDNAQKN------PTDV-WAFR 121

  Fly   138 AFVCVLATPVGE 149
            ...|::|:.:|:
  Fly   122 GHQCMMASKIGD 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp8aNP_727322.1 PhBP 43..144 CDD:214783 32/105 (30%)
Obp99cNP_651711.1 PBP_GOBP 17..128 CDD:279703 34/119 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450216
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009982
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.